BNP32 Antikörper
-
- Target Alle BNP32 (BNP 32) Antikörper anzeigen
- BNP32 (BNP 32) (Brain Natriuretic Peptide 32 (BNP 32))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BNP32 Antikörper ist unkonjugiert
-
Applikation
- ELISA, Immunohistochemistry (IHC), Dot Blot (DB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Marke
- IHC-plus™
- Aufreinigung
- Protein G purified
- Immunogen
-
Synthetic peptide (Human BNP: NH2-CSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH) conjugated with KLH
Type of Immunogen: Synthetic peptide - KLH conjugated - Isotyp
- IgG
-
-
- Applikationshinweise
- Approved: DB, ELISA (1:40000), IHC, IHC-P (10 μg/mL)
- Kommentare
-
Target Species of Antibody: Human
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Reconstitute at 1 mg/mL in PBS
- Konzentration
- Lot specific
- Buffer
- Lyophilized from PBS. No preservative added
- Konservierungsmittel
- Without preservative
-
- Target
- BNP32 (BNP 32) (Brain Natriuretic Peptide 32 (BNP 32))
- Abstract
- BNP 32 Produkte
-