HOXC4 Antikörper (N-Term)
-
- Target Alle HOXC4 Antikörper anzeigen
- HOXC4 (Homeobox C4 (HOXC4))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Zebrafisch (Danio rerio), Hund, Rind (Kuh)
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HOXC4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Sequenz
- MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQ
- Kreuzreaktivität (Details)
- Species reactivity (expected):Mouse, Rat, Dog, Zebrafish, BovineSpecies reactivity (tested):Human
- Aufreinigung
- Purified on Protein A affinity column.
- Immunogen
- The immunogen for anti-HOXC4 antibody: synthetic peptide directed towards the N terminal of human HOXC4.
- Top Product
- Discover our top product HOXC4 Primärantikörper
-
-
- Applikationshinweise
- Optimal working dilution should be determined by the investigator.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Rekonstitution
- Add 100 μL of distilled water
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- -20 °C
- Informationen zur Lagerung
- Store the lyophised antibody at -20 °C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20 °C long term.
- Haltbarkeit
- 12 months
-
- Target
- HOXC4 (Homeobox C4 (HOXC4))
- Andere Bezeichnung
- HOXC4 / HOX3E (HOXC4 Produkte)
- Synonyme
- HOXC4 antikoerper, Hox3r3 antikoerper, hoxc4 antikoerper, z-96 antikoerper, zgc:110513 antikoerper, HOX3 antikoerper, HOX3E antikoerper, cp19 antikoerper, Hox-3.5 antikoerper, homeobox C4 antikoerper, homeo box C4 antikoerper, homeobox C4a antikoerper, hoxc4 antikoerper, HOXC4 antikoerper, Hoxc4 antikoerper, hoxc4a antikoerper
- Hintergrund
- HOXC4 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, are co-transcribed in a primary transcript. Subsequent processing results in gene-specific transcripts, which sometimes share a 5' non-coding exon.Synonyms: CP19, Homeobox protein Hox-C4, Hox-3E
- Gen-ID
- 3221
- NCBI Accession
- NP_705897
-