IVNS1ABP Antikörper (N-Term)
-
- Target Alle IVNS1ABP Antikörper anzeigen
- IVNS1ABP (Influenza Virus NS1A Binding Protein (IVNS1ABP))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund, Rind (Kuh), Zebrafisch (Danio rerio), Schwein, Xenopus laevis
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IVNS1ABP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Sequenz
- MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVL
- Kreuzreaktivität (Details)
- Species reactivity (expected):Mouse, Dog, Rat, African clawed frog, Bovine, Pig, ZebrafishSpecies reactivity (tested):Human
- Aufreinigung
- Purified using Protein A affinity column
- Immunogen
- The immunogen for anti-IVNS1ABP antibody: synthetic peptide directed towards the N terminal of human IVNS1ABP.
- Top Product
- Discover our top product IVNS1ABP Primärantikörper
-
-
- Applikationshinweise
- Optimal working dilution should be determined by the investigator.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Rekonstitution
- Add 100 μL of distilled water to a final concentration of 1 mg/mL.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or in aliquots at -20 °C long term.
-
- Target
- IVNS1ABP (Influenza Virus NS1A Binding Protein (IVNS1ABP))
- Andere Bezeichnung
- IVNS1ABP (IVNS1ABP Produkte)
- Synonyme
- 1190004M08Rik antikoerper, 1700126I16Rik antikoerper, AA960440 antikoerper, HSPC068 antikoerper, ND1 antikoerper, NS-1 antikoerper, NS1-BP antikoerper, Nd1-L antikoerper, Nd1-S antikoerper, mKIAA0850 antikoerper, cb1052 antikoerper, fj23g11 antikoerper, ivns1abp antikoerper, wu:fj23g11 antikoerper, FLARA3 antikoerper, KLHL39 antikoerper, NS1BP antikoerper, fi13f08 antikoerper, fi41c09 antikoerper, wu:fi13f08 antikoerper, wu:fi41c09 antikoerper, influenza virus NS1A binding protein antikoerper, influenza virus NS1A binding protein a antikoerper, influenza virus NS1A binding protein L homeolog antikoerper, influenza virus NS1A binding protein b antikoerper, Ivns1abp antikoerper, ivns1abpa antikoerper, ivns1abp.L antikoerper, IVNS1ABP antikoerper, ivns1abpb antikoerper
- Substanzklasse
- Influenza Protein
- Hintergrund
- This gene encodes a protein which interacts with the nonstructural NS1 protein of the influenza A virus. In noninfected cells, affinity-purified antibodies localized this protein in nuclear regions enriched with the spliceosome assembly factor SC35, suggesting an association with the cellular splicing apparatus. In influenza A virus-infected cells, the protein relocalized throughout the nucleoplasm and appeared distinct from the SC35 domains, which suggests that its function may be disturbed or altered.Synonyms: ARA3, Aryl hydrocarbon receptor-associated protein 3, FLARA3, HSPC068, Influenza virus NS1A-binding protein, KIAA0850, NS1, NS1-binding protein, NS1BP
- Gen-ID
- 10625
- NCBI Accession
- NP_006460
- Pathways
- Negative Regulation of intrinsic apoptotic Signaling
-