SNF8 Antikörper (N-Term)
-
- Target Alle SNF8 Antikörper anzeigen
- SNF8 (Vacuolar-sorting Protein SNF8 (SNF8))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte, Maus, Rind (Kuh), Hund, Zebrafisch (Danio rerio), Xenopus laevis, Huhn
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SNF8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Sequenz
- MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEF
- Kreuzreaktivität (Details)
- Species reactivity (expected):Mouse, Rat, African clawed frog, Bovine, Dog, Chicken, ZebrafishSpecies reactivity (tested):Human
- Aufreinigung
- Purified on peptide immunoaffinity column
- Immunogen
- The immunogen for anti-EAP30 antibody: synthetic peptide directed towards the N terminal of human EAP30
- Top Product
- Discover our top product SNF8 Primärantikörper
-
-
- Applikationshinweise
- Optimal working dilution should be determined by the investigator.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Rekonstitution
- Add 50 μL of distilled water
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- -20 °C
- Informationen zur Lagerung
- Store the lyophised antibody at -20 °C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20 °C long term.
- Haltbarkeit
- 12 months
-
- Target
- SNF8 (Vacuolar-sorting Protein SNF8 (SNF8))
- Andere Bezeichnung
- Vacuolar-Sorting Protein SNF8 (SNF8 Produkte)
- Synonyme
- d11moh34 antikoerper, vps22 antikoerper, Dot3 antikoerper, EAP30 antikoerper, VPS22 antikoerper, D11moh34 antikoerper, RGD1310144 antikoerper, D11Moh34 antikoerper, D11MOH34 antikoerper, zgc:101578 antikoerper, SNF8, ESCRT-II complex subunit antikoerper, eap30 subunit of ell complex, putative antikoerper, EAP30 subunit of ELL complex antikoerper, SNF8, ESCRT-II complex subunit S homeolog antikoerper, SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae) antikoerper, snf8 antikoerper, TA17290 antikoerper, TVAG_107410 antikoerper, Bm1_05145 antikoerper, SNF8 antikoerper, Snf8 antikoerper, snf8.S antikoerper
- Hintergrund
- ELL encodes an RNA polymerase II transcription factor that undergoes frequent translocation in acute myeloid leukemia (AML). In addition to its elongation activity, ELL contains a novel type of RNA polymerase II interaction domain that is capable of repressing polymerase activity in promoter-specific transcription. EAP30 is a subunit of the ELL complex. EAP30 can interact with ELL and derepress ELL's inhibitory activity in vitro.SNF8, VPS25, and VPS36 form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation facto.Synonyms: EAP30, ELL-associated protein of 30 kDa, ESCRT-II complex subunit VPS22
- Gen-ID
- 11267
- NCBI Accession
- NP_009172
-