CD49c / CD49f (Isoform B), (N-Term) Antikörper

Produktnummer ABIN112370

Produktdetails

Target: CD49c / CD49f

Bindungsspezifität: Isoform B, N-Term

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Applikation: Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunofluorescence (IF), Western Blotting (WB)

Kreuzreaktivität (Details): Species reactivity (expected):A broad species reactivity is expected because of the conserved nature of the epitope.
Species reactivity (tested):Human.

Aufreinigung: Purified

Immunogen: PB36 is a mouse monoclonal IgG1, k antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin a3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.

Klon: PB36

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: Suitable for Immunoblotting, Immunocytochemistry, Immunohistochemistry on frozentissues. Recommended dilutions: 1/50-1/100 for Immunohistochemistry with avidin-biotinylatedhorseradish peroxidase complex (ABC) as detection reagent, and 1/100-1/500 forImmunoblotting applications.
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Konzentration: 1.0 mg/mL

Buffer: PBS with 0.09 % Sodium Azide as preservative.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store lyophilized at 2-8 °C. After reconstitution aliquot and store at -20 °C.

Antigendetails

Target: CD49c / CD49f

Hintergrund: Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated a and b subunits. More than 18 a and 8 b subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migration and apoptosis. For integrin subunits a3 and a6, two cytoplasmic variants, A and B, have been identified.Synonyms: Integrin alpha 3B / Integrin alpha 6B