ZNF93 Antikörper
-
- Target Alle ZNF93 Antikörper anzeigen
- ZNF93 (Zinc Finger Protein 93 (ZNF93))
-
Reaktivität
- Human, Maus, Ratte, Zebrafisch (Danio rerio), Rind (Kuh), Xenopus laevis
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ZNF93 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Kreuzreaktivität (Details)
- Species reactivity (tested):Human, Mouse, Rat, Zebrafish, African clawed frog, Bovine
- Aufreinigung
- Purified using peptide immunoaffinity column
- Immunogen
- A synthetic peptide located within the following region of human ZNF93: FNQFSTLITHKKIHTGEKPYICEECGKAFKYSSALNTHKRIHTGEKPYKC
- Top Product
- Discover our top product ZNF93 Primärantikörper
-
-
- Applikationshinweise
- Optimal working dilution should be determined by the investigator.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Rekonstitution
- Add 50 μL of distilled water to a final concentration of 1 mg/mL.
- Konzentration
- 1.0 mg/mL after reconstitution
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or in aliquots at -20 °C long term.
-
- Target
- ZNF93 (Zinc Finger Protein 93 (ZNF93))
- Andere Bezeichnung
- ZNF93 (ZNF93 Produkte)
- Synonyme
- ZNF354A antikoerper, MGC143044 antikoerper, HPF34 antikoerper, HTF34 antikoerper, TF34 antikoerper, ZNF505 antikoerper, Znf235 antikoerper, zinc finger protein 93 antikoerper, ZNF93 antikoerper, Zfp93 antikoerper
- Hintergrund
- ZNF93 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.Synonyms: HTF34, ZNF505, Zinc finger protein 505, Zinc finger protein 93, Zinc finger protein HTF34
- Molekulargewicht
- 71 kDa (620 aa)
- Gen-ID
- 81931
- NCBI Accession
- NP_112495
-