Ataxin 1 Antikörper (AA 164-197) (FITC)

Produktnummer ABIN1741209

Produktdetails anti-Ataxin 1 Antikörper (FITC)

Target: Ataxin 1 (ATXN1)

Bindungsspezifität: AA 164-197

Reaktivität: Maus

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser Ataxin 1 Antikörper ist konjugiert mit FITC

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunoprecipitation (IP), Immunocytochemistry (ICC)

Spezifität: Detects ~85 kDa.

Kreuzreaktivität: Human, Maus, Ratte

Aufreinigung: Protein G Purified

Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).

Klon: S76-8

Isotyp: IgG2b

Anwendungsinformationen

Applikationshinweise:

• WB (1:1000)
• ICC/IF (1:100)
• optimal dilutions for assays should be determined by the user.

Kommentare:

1 μg/ml of ABIN1741209 was sufficient for detection of Ataxin-1 in 20 μg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 1 mg/mL

Buffer: PBS pH 7.4, 50 % glycerol, 0.1 % sodium azide, Storage buffer may change when conjugated

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C

Informationen zur Lagerung: Conjugated antibodies should be stored at 4°C

Details zu Ataxin 1

Target: Ataxin 1 (ATXN1)

Andere Bezeichnung: Ataxin 1 (ATXN1 Produkte)

Synonyme: ATX1 antikoerper, D6S504E antikoerper, SCA1 antikoerper, ATXN1 antikoerper, ataxin 1b antikoerper, atxn1 antikoerper, 2900016G23Rik antikoerper, Atx1 antikoerper, C85907 antikoerper, ENSMUSG00000074917 antikoerper, Gm10786 antikoerper, Sca1 antikoerper, CG4547 antikoerper, Dmel\\CG4547 antikoerper, dAtx-1 antikoerper, dAtx1 antikoerper, sca1 antikoerper, ataxin 1 antikoerper, ataxin 1b antikoerper, Ataxin 1 antikoerper, ATXN1 antikoerper, atxn1b antikoerper, Atxn1 antikoerper, Atx-1 antikoerper

Hintergrund: Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent inclusions within the nucleus. A mutation of Ataxin-1 is the cause of spinocerebellar ataxia type-1 (SCA1), a progressive, neurodegenerative disease that is autosomal dominant and primarily affects the Purjinke cells found in brain stem neuronal populations and the cerebellum. Expression of Ataxin-1 is almost ubiquitous, except in the brain where it is isolated to populations of neurons.

Gen-ID: 20238

NCBI Accession: NP_001186233

UniProt: P54254

Pathways: Synaptic Membrane