NMS Antikörper (AA 70-103)
-
- Target Alle NMS Antikörper anzeigen
- NMS (Neuromedin S (NMS))
-
Bindungsspezifität
- AA 70-103
-
Reaktivität
- Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NMS Antikörper ist unkonjugiert
-
Applikation
- ELISA
- Spezifität
- Mouse Neuromedin S.
- Aufreinigung
- Protein A purified
- Immunogen
-
Synthetic peptide corresponding to aa70-103 of mouse prepro-Neuromedin S (FLFHYSRTRKPTHPVSAEFAPVHPLMRLAAKLAS).
Type of Immunogen: Synthetic peptide - Isotyp
- IgG
- Top Product
- Discover our top product NMS Primärantikörper
-
anti-Neuromedin S (NMS) (AA 31-153) antibody
NMS Reaktivität: Maus WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Neuromedin S (NMS) (C-Term) antibodyNMS Reaktivität: Human ELISA, WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Neuromedin S (NMS) (AA 1-153) antibodyNMS Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Neuromedin S (NMS) (C-Term) antibodyNMS Reaktivität: Human ELISA, WB, ICC, IF Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
- Optimal working dilution should be determined by the investigator.
- Kommentare
-
Target Species of Antibody: Mouse
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- PBS
- Konzentration
- Lot specific
- Buffer
- Lyophilized from PBS, pH 7
- Handhabung
- Aliquot to avoid repeated freezing and thawing.
- Lagerung
- -20 °C
- Informationen zur Lagerung
- Lyophilized powder may be stored at -20°C. Stable for 1 year at -20°C. Aliquot to avoid freeze-thaw cycles. Store at -20°C. Reconstituted product is stable for 1 year at -20°C.
-
- Target
- NMS (Neuromedin S (NMS))
- Andere Bezeichnung
- NMS (NMS Produkte)
- Synonyme
- AB164466 antikoerper, neuromedin S antikoerper, NMS antikoerper, nms antikoerper, Nms antikoerper
- Hintergrund
-
Name/Gene ID: NMS
Synonyms: NMS, FLGRACILE, Neuromedin-S, Neuromedin S, PTD, BJS - Gen-ID
- 129521
- UniProt
- Q5H8A3
-
