beta 2 Defensin Antikörper (AA 4-41)
(1 reference)-
- Target Alle beta 2 Defensin (BD-2) Antikörper anzeigen
- beta 2 Defensin (BD-2) (Defensin beta 2 (BD-2))
-
Bindungsspezifität
- AA 4-41
-
Reaktivität
- Human
-
Wirt
- Maus
-
Klonalität
- Monoklonal
-
Konjugat
- Dieser beta 2 Defensin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Enzyme Immunoassay (EIA)
- Spezifität
- This antibody recognizes Human beta-Defensin 2 (aa 4-41).
- Produktmerkmale
- Synonyms: Beta-defensin 4A, Beta-defensin 2, BD-2, hBD-2, DEFB102, DEFB2, Skin-antimicrobialpeptide 1, DEFB4B, DEFB4A
- Aufreinigung
- Protein G Chromatography
- Immunogen
- Synthetic peptide corresponding to amino acids 4-41 of Human beta-Defensin 2. AA Sequence: DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
- Klon
- L12-4C-C2
- Isotyp
- IgG1
- Top Product
- Discover our top product BD-2 Primärantikörper
-
anti-Defensin beta 2 (BD-2) (AA 24-64) antibody
BD-2 Reaktivität: Human WB, ELISA, IHC (p), ICC, IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Defensin beta 2 (BD-2) (AA 21-71) antibodyBD-2 Reaktivität: Maus WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Defensin beta 2 (BD-2) (AA 21-71) antibodyBD-2 Reaktivität: Maus IF (cc), IF (p), ELISA, IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Defensin beta 2 (BD-2) (AA 23-63) antibodyBD-2 Reaktivität: Ratte WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Defensin beta 2 (BD-2) (AA 21-71) antibodyBD-2 Reaktivität: Human, Ratte WB, IF (cc), IF (p), ELISA, IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Defensin beta 2 (BD-2) (AA 4-41) antibodyBD-2 Reaktivität: Human WB, ELISA, IHC (p) Wirt: Maus Monoclonal L12-4C-C2 unconjugated
-
- Applikationshinweise
-
ELISA.
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user. - Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Rekonstitution
- Restore in 0.1 mL aqua bidest to 1 mg/mL.
- Buffer
- 50 mM TRIS pH 7.4
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
Store lyophilized at 2-8 °C and reconstituted at -20 °C. Avoid repeated freezing and thawing.
Shelf life: One year from despatch. - Haltbarkeit
- 12 months
-
-
: "Towards the development of a RNAi-based topical treatment for psoriasis: Proof-of-concept in a 3D psoriasis skin model." in: Experimental dermatology, (2018) (PubMed).
-
: "Towards the development of a RNAi-based topical treatment for psoriasis: Proof-of-concept in a 3D psoriasis skin model." in: Experimental dermatology, (2018) (PubMed).
-
- Target
- beta 2 Defensin (BD-2) (Defensin beta 2 (BD-2))
- Andere Bezeichnung
- Defensin beta 2 (BD-2 Produkte)
- Hintergrund
- This antibiotic peptide is locally regulated by inflammation. Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence.Synonyms: BD-2, Beta-defensin 2, Beta-defensin 4A, DEFB102, DEFB2, DEFB4A, DEFB4B, Skin-antimicrobial peptide 1, hBD-2
- Gen-ID
- 100289462
- UniProt
- O15263
-
