Integrin alpha 3a Antikörper (Cytoplasmic Domain)

Produktnummer ABIN2295550

Produktdetails anti-Integrin alpha 3a Antikörper

Target: Integrin alpha 3a

Bindungsspezifität: Cytoplasmic Domain

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser Integrin alpha 3a Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB), Immunochromatography (IC)

Sequenz: CRTRALYEAK RQKAEMKSQP SETERLTDDY

Kreuzreaktivität: Human

Kreuzreaktivität (Details): Calculated cross reactivity: Hu

Produktmerkmale: Integrin alpha 3A

Aufreinigung: Purified by Protein G affinity chromatography.

Immunogen: Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.

Klon: 29A3

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: Optimal working conditions should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Buffer: Supplied as a liquid in PBS, pH 7.2, 0.09 % sodium azide. No stabilizing proteins added.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: -20 °C

Informationen zur Lagerung: -20°C

Details zu Integrin alpha 3a

Target: Integrin alpha 3a

Abstract: Integrin alpha 3a Produkte