ABCC9 Antikörper (AA 1505-1546) (Atto 390)
-
- Target Alle ABCC9 Antikörper anzeigen
- ABCC9 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9))
-
Bindungsspezifität
- AA 1505-1546
-
Reaktivität
- Maus
-
Wirt
- Maus
-
Klonalität
- Monoklonal
-
Konjugat
- Dieser ABCC9 Antikörper ist konjugiert mit Atto 390
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunofluorescence (IF)
- Spezifität
- Detects ~120 kDa. Does not cross-react with SUR2B.
- Kreuzreaktivität
- Human, Maus, Ratte
- Aufreinigung
- Protein G Purified
- Immunogen
- Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
- Klon
- S319A-14
- Isotyp
- IgG2a
- Top Product
- Discover our top product ABCC9 Primärantikörper
-
-
- Applikationshinweise
-
- WB (1:1000)
- optimal dilutions for assays should be determined by the user.
- Kommentare
-
1 μg/ml of ABIN2482968 was sufficient for detection of SUR2A in 20 μg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Konzentration
- 1 mg/mL
- Buffer
- PBS pH 7.4, 50 % glycerol, 0.1 % sodium azide, Storage buffer may change when conjugated
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C
- Informationen zur Lagerung
- Conjugated antibodies should be stored at 4°C
-
- Target
- ABCC9 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9))
- Andere Bezeichnung
- SUR2A (ABCC9 Produkte)
- Synonyme
- SUR2B antikoerper, DDBDRAFT_0215814 antikoerper, DDBDRAFT_0216237 antikoerper, DDB_0215814 antikoerper, DDB_0216237 antikoerper, si:dkey-183c2.3 antikoerper, sur2 antikoerper, ABC37 antikoerper, ATFB12 antikoerper, CANTU antikoerper, CMD1O antikoerper, SUR2 antikoerper, SUR2A antikoerper, AI414027 antikoerper, AI449286 antikoerper, Sur2 antikoerper, ABCC9 antikoerper, ATP binding cassette subfamily C member 9 antikoerper, ATP-binding cassette sub-family C member 8 antikoerper, ABC transporter C family protein antikoerper, ATP-binding cassette sub-family C member 9 antikoerper, ATP-binding cassette, sub-family C (CFTR/MRP), member 9 antikoerper, ABCC9 antikoerper, LOC581821 antikoerper, abcC9 antikoerper, LOC100470981 antikoerper, abcc9 antikoerper, Abcc9 antikoerper
- Hintergrund
- Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2) (1). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell (2).
- Gen-ID
- 20928
- NCBI Accession
- NP_001038185
- UniProt
- P70170
-