VEGFA Antikörper
-
- Target Alle VEGFA Antikörper anzeigen
- VEGFA (Vascular Endothelial Growth Factor A (VEGFA))
-
Reaktivität
- Human, Ratte, Maus, Schwein, Hund, Kaninchen, Huhn, Rind (Kuh), Meerschweinchen, Schaf, Pferd, Affe, Cat, Esel, Ziege, Hamster
-
Wirt
- Ziege
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser VEGFA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunofluorescence (IF)
- Spezifität
- Detects endogenous levels of total VEGFA by Western blot in whole cell and tissue lysates.
- Aufreinigung
- Immunoaffinity purified
- Immunogen
- Purified recombinant human VEGFA isoform 6 produced in E. coli. corresponding to P15692-6 (MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD)
- Isotyp
- IgG
- Top Product
- Discover our top product VEGFA Primärantikörper
-
-
- Applikationshinweise
- Approved: IF (1:50 - 1:250), WB (1:500 - 1:2000)
- Kommentare
-
Target Species of Antibody: Human
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Konzentration
- Lot specific
- Buffer
- PBS, 20 % glycerol, 0.05 % sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
- Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
-
- Target
- VEGFA (Vascular Endothelial Growth Factor A (VEGFA))
- Andere Bezeichnung
- VEGFA / VEGF (VEGFA Produkte)
- Hintergrund
-
Name/Gene ID: VEGFA
Family: PDGF
Synonyms: VEGFA, VPF, Vascular permeability factor, VEGF, VEGF-A, MVCD1 - Gen-ID
- 7422
- UniProt
- P15692
- Pathways
- RTK Signalweg, Glycosaminoglycan Metabolic Process, Regulation of Cell Size, Tube Formation, Signaling Events mediated by VEGFR1 and VEGFR2, Platelet-derived growth Factor Receptor Signaling, VEGFR1 Specific Signals, VEGF Signaling
-