HKDC1 Antikörper (AA 102-136)

Produktnummer ABIN2741387

Produktdetails anti-HKDC1 Antikörper

Target: HKDC1 (Hexokinase Domain Containing 1 (HKDC1))

Bindungsspezifität: AA 102-136

Reaktivität: Human, Schimpanse, Orang-Utan

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HKDC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HKDC1(102-136aa KRHVQMESQFYPTPNEIIRGNGTELFEYVADCLAD), different from the related mouse sequence by four amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Distilled water

Konzentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: avoid freeze thaw cycles

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Details zu HKDC1

Target: HKDC1 (Hexokinase Domain Containing 1 (HKDC1))

Andere Bezeichnung: HKDC1 (HKDC1 Produkte)

Synonyme: cb370 antikoerper, sb:cb370 antikoerper, HKDC1 antikoerper, BC016235 antikoerper, hexokinase domain containing 1 antikoerper, putative hexokinase HKDC1 antikoerper, hkdc1 antikoerper, HKDC1 antikoerper, LOC100088018 antikoerper, Hkdc1 antikoerper

Hintergrund: Name/Gene ID: HKDC1

Synonyms: HKDC1, Putative hexokinase HKDC1, Hexokinase domain containing 1

Gen-ID: 80201