EPH Receptor B1 Antikörper (N-Term)
-
- Target Alle EPH Receptor B1 (EPHB1) Antikörper anzeigen
- EPH Receptor B1 (EPHB1)
-
Bindungsspezifität
- AA 56-88, N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EPH Receptor B1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Ephrin type-B receptor 1(EPHB1) detection. Tested with WB, IHC-P in Human.
- Sequenz
- RTYQVCNVFE PNQNNWLLTT FINRRGAHRI YTE
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Ephrin type-B receptor 1(EPHB1) detection. Tested with WB, IHC-P in Human.
Gene Name: EPH receptor B1
Protein Name: Ephrin type-B receptor 1 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human Eph receptor B1 (56-88aa RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE) , identical to the related mouse and rat sequences.
- Isotyp
- IgG
- Top Product
- Discover our top product EPHB1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- EPH Receptor B1 (EPHB1)
- Andere Bezeichnung
- EPHB1 (EPHB1 Produkte)
- Hintergrund
-
Ephrin type-B receptor 1 is a protein that in humans is encoded by the EPHB1 gene. Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members.
Synonyms: Cek 6 antibody|EK6 antibody|ELK antibody|Elkh antibody|EPH receptor B1 antibody|Eph tyrosine kinase 2 antibody|EPH-like kinase 6 antibody|Ephb1 antibody|EPHB1_HUMAN antibody|Ephrin type B receptor 1 antibody|Ephrin type-B receptor 1 antibody|EPHT2 antibody|HEK 6 antibody|HEK6 antibody|NET antibody|Neuronally-expressed EPH-related tyrosine kinase antibody|soluble EPHB1 variant 1 antibody| Tyrosine protein kinase receptor EPH 2 antibody|Tyrosine-protein kinase receptor EPH-2 antibody - Gen-ID
- 2047
- UniProt
- P54762
- Pathways
- RTK Signalweg
-