FLT3LG Antikörper (N-Term)
-
- Target Alle FLT3LG Antikörper anzeigen
- FLT3LG (Fms-Related tyrosine Kinase 3 Ligand (FLT3LG))
-
Bindungsspezifität
- AA 79-110, N-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FLT3LG Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Fms-related tyrosine kinase 3 ligand(FLT3LG) detection. Tested with WB in Human,Rat.
- Sequenz
- AQRWMERLKT VAGSKMQGLL ERVNTEIHFV TK
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Fms-related tyrosine kinase 3 ligand(FLT3LG) detection. Tested with WB in Human,Rat.
Gene Name: fms-related tyrosine kinase 3 ligand
Protein Name: Fms-related tyrosine kinase 3 ligand - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human Flt-3ligand (79-110aa AQRWMERLKTVAGSKMQGLLERVNTEIHFVTK), different from the related mouse sequence by four amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product FLT3LG Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- FLT3LG (Fms-Related tyrosine Kinase 3 Ligand (FLT3LG))
- Andere Bezeichnung
- FLT3LG (FLT3LG Produkte)
- Synonyme
- Flt3lg antikoerper, Ly72L antikoerper, FL antikoerper, FLT3L antikoerper, Vegfr3 antikoerper, fms related tyrosine kinase 3 ligand antikoerper, FMS-like tyrosine kinase 3 ligand antikoerper, fms-related tyrosine kinase 4 antikoerper, fms-related tyrosine kinase 3 ligand antikoerper, FLT3LG antikoerper, Flt3l antikoerper, Flt4 antikoerper, Flt3lg antikoerper
- Hintergrund
-
FLT3LG (FMS-Related Tyrosine Kinase 3 Ligand) also called FLT3 LIGAND, FL or FLT3L, is a protein which in humans is encoded by the FLT3LG gene. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8-positive classical DCs and their CD103-positive tissue counterparts. Flt3 ligand (FL) is a hematopoietic four helical bundlecytokine. It is structurally homologous to stem cell factor (SCF) and colony stimulating facor 1 (CSF-1). In synergy with other growth factors, Flt3 ligand stimulates the proliferation and differentiation of various blood cell progenitors. Lyman et al. (1993) found that Flt3 ligand stimulated proliferation of hematopoietic progenitor cells isolated from mouse fetal liver or adult mouse bone marrow. Hannum et al. (1994) concluded that FL enhances the response of stem and primitive progenitor cells to other growth factors to generate all myeloid lineages except erythroid cells. Assays of C-terminally truncated FL proteins confirmed that the N-terminal half conferred FL activity. Depletion of the Pi3k -Mtor negative regulator Pten facilitated Flt3l-driven DC development in culture.
Synonyms: Flt 3 ligand antibody|Flt 3L antibody|Flt3 L antibody|FLT3 LG antibody|Flt3 ligand antibody|Flt3L antibody|FLT3L_HUMAN antibody|FLT3LG antibody|Fms related tyrosine kinase 3 ligand antibody|Fms-related tyrosine kinase 3 ligand antibody|SL cytokine antibody - Gen-ID
- 2323
- UniProt
- P49771
- Pathways
- RTK Signalweg
-