FOXA3 Antikörper (C-Term)
-
- Target Alle FOXA3 Antikörper anzeigen
- FOXA3 (Forkhead Box A3 (FOXA3))
-
Bindungsspezifität
- AA 291-324, C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FOXA3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Hepatocyte nuclear factor 3-gamma(FOXA3) detection. Tested with WB in Human,Mouse,Rat.
- Sequenz
- ELKLDAPYNF NHPFSINNLM SEQTPAPPKL DVGF
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Hepatocyte nuclear factor 3-gamma(FOXA3) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: forkhead box A3
Protein Name: Hepatocyte nuclear factor 3-gamma - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human FOXA3 (291-324aa ELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGF), different from the related mouse and rat sequences by three amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product FOXA3 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- FOXA3 (Forkhead Box A3 (FOXA3))
- Andere Bezeichnung
- FOXA3 (FOXA3 Produkte)
- Hintergrund
-
Hepatocyte nuclear factor 3-gamma (HNF-3G), also known as forkhead box protein A3 (FOXA3) or transcription factor 3G (TCF-3G), is a protein that in humans is encoded by the FOXA3 gene. This gene is mapped to 19q13.32. HNF-3G is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved.
Synonyms: FKHH3 antibody|Fork head-related protein FKH H3 antibody|forkhead box A3 antibody|Forkhead box protein A3 antibody|Foxa3 antibody| FOXA3_HUMAN antibody|hepatic nuclear factor-3-beta antibody|hepatocyte nuclear factor 3 antibody|hepatocyte nuclear factor 3 gamma antibody|Hepatocyte nuclear factor 3-gamma antibody|HNF-3-gamma antibody|HNF-3G antibody|HNF3B antibody|HNF3G antibody|TCF-3G antibody|TCF3G antibody|Transcription factor 3G antibody - Gen-ID
- 3171
- UniProt
- P55318
- Pathways
- Carbohydrate Homeostasis
-