GRK5 Antikörper (C-Term)

Produktnummer ABIN3042434

Produktdetails anti-GRK5 Antikörper

Target: GRK5 (G Protein-Coupled Receptor Kinase 5 (GRK5))

Bindungsspezifität: AA 393-429, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GRK5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for G protein-coupled receptor kinase 5(GRK5) detection. Tested with WB, IHC-P in Human,Rat,Mouse.

Sequenz: KREEVDRRVL ETEEVYSHKF SEEAKSICKM LLTKDAK

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for G protein-coupled receptor kinase 5(GRK5) detection. Tested with WB, IHC-P in Human,Rat,Mouse.
Gene Name: G protein-coupled receptor kinase 5
Protein Name: G protein-coupled receptor kinase 5

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human GRK5 (393-429aa KREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAK), different from the related mouse and rat sequences by three amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu GRK5

Target: GRK5 (G Protein-Coupled Receptor Kinase 5 (GRK5))

Andere Bezeichnung: GRK5 (GRK5 Produkte)

Synonyme: GPRK5 antikoerper, Gprk5 antikoerper, si:dkey-171l20.1 antikoerper, GRK5 antikoerper, DKFZp468J1119 antikoerper, grk5 antikoerper, G protein-coupled receptor kinase 5 antikoerper, G protein-coupled receptor kinase 5 L homeolog antikoerper, GRK5 antikoerper, Grk5 antikoerper, grk5 antikoerper, grk5.L antikoerper

Hintergrund: G protein-coupled receptor kinase 5 is an enzyme that in humans is encoded by the GRK5 gene. It is mapped to 10q26.11. This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs).

Synonyms: FLJ39780 antibody|FP2025 antibody|G protein coupled receptor kinase 5 antibody|G protein coupled receptor kinase GRK5 antibody|G protein-coupled receptor kinase 5 antibody|G protein-coupled receptor kinase GRK5 antibody|GPRK5 antibody|GRK-pan antibody|GRK5 antibody|GRK5_HUMAN antibody|Pan-GRK antibody

Gen-ID: 2869

UniProt: P34947

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling