HMGB3 Antikörper (N-Term)

Produktnummer ABIN3042447

Produktdetails anti-HMGB3 Antikörper

Target: HMGB3 (High Mobility Group Box 3 (HMGB3))

Bindungsspezifität: AA 62-95, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HMGB3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for High mobility group protein B3(HMGB3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: EMAKADKVRY DREMKDYGPA KGGKKKKDPN APKR

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for High mobility group protein B3(HMGB3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: high mobility group box 3
Protein Name: High mobility group protein B3

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HMG4 (62-95aa EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu HMGB3

Target: HMGB3 (High Mobility Group Box 3 (HMGB3))

Andere Bezeichnung: HMGB3 (HMGB3 Produkte)

Synonyme: HMG-2a antikoerper, HMG-4 antikoerper, HMG2A antikoerper, HMG4 antikoerper, Hmg2a antikoerper, Hmg4 antikoerper, RGD1564407 antikoerper, hmgb3 antikoerper, MGC54022 antikoerper, Xhmgb3 antikoerper, MGC88931 antikoerper, fa19b06 antikoerper, fj43d02 antikoerper, wu:fa19b06 antikoerper, wu:fj43d02 antikoerper, zgc:112073 antikoerper, HMGB3 antikoerper, NFD03 antikoerper, NFD3 antikoerper, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR antikoerper, high mobility group B3 antikoerper, HMG-1 antikoerper, HMG2a antikoerper, HMGB1 antikoerper, high mobility group box 3 antikoerper, high mobility group box 3b antikoerper, high mobility group box 3 S homeolog antikoerper, high mobility group protein antikoerper, high mobility group B3 antikoerper, High mobility group protein B3 antikoerper, HMGB3 antikoerper, Hmgb3 antikoerper, hmgb3 antikoerper, hmgb3b antikoerper, hmgb3.S antikoerper

Hintergrund: High-mobility group protein B, also known as HMG4, is a protein that in humans is encoded by the HMGB3 gene. This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants.

Synonyms: chromosomal protein, Nonhistone, HMG4 antibody|High mobility group (nonhistone chromosomal) protein 4 antibody|High mobility group box 3 antibody|High mobility group protein 2a antibody|High mobility group protein 4 antibody|High mobility group protein B3 antibody| High mobility group protein HMG4 antibody|HMG 4 antibody|HMG-2a antibody|HMG-4 antibody|HMG2A antibody|HMGB 3 antibody|HMGB3 antibody| HMGB3_HUMAN antibody|MGC90319 antibody|Non histone chromosomal protein antibody|Nonhistone chromosomal protein HMG4 antibody

Gen-ID: 3149

UniProt: O15347