IRF2 Antikörper (C-Term)
-
- Target Alle IRF2 Antikörper anzeigen
- IRF2 (Interferon Regulatory Factor 2 (IRF2))
-
Bindungsspezifität
- AA 317-348, C-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IRF2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Interferon regulatory factor 2(IRF2) detection. Tested with WB in Human,Rat.
- Sequenz
- MTPASSSSRP DRETRASVIK KTSDITQARV KS
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Interferon regulatory factor 2(IRF2) detection. Tested with WB in Human,Rat.
Gene Name: interferon regulatory factor 2
Protein Name: Interferon regulatory factor 2 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human IRF2 (317-348aa MTPASSSSRPDRETRASVIKKTSDITQARVKS), different from the related mouse sequence by three amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product IRF2 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- IRF2 (Interferon Regulatory Factor 2 (IRF2))
- Andere Bezeichnung
- IRF2 (IRF2 Produkte)
- Synonyme
- IRF-2 antikoerper, 9830146E22Rik antikoerper, AI646973 antikoerper, Irf-2 antikoerper, irf2b antikoerper, zgc:103451 antikoerper, irf-2 antikoerper, wu:fc74h04 antikoerper, zgc:76951 antikoerper, interferon regulatory factor 2 antikoerper, interferon regulatory factor 2 L homeolog antikoerper, interferon regulatory factor 2a antikoerper, IRF2 antikoerper, Irf2 antikoerper, irf2 antikoerper, irf2.L antikoerper, irf2a antikoerper
- Hintergrund
-
IRF2 (interferon regulatory factor 2) is a member of the interferon regulatory transcription factor (IRF) family. The IRF2 gene is mapped on 4q35.1. When the IRF2 gene was overexpressed in NIH 3T3 cells, the cells became transformed and displayed enhanced tumorigenicity in nude mice. One IRF binding site was found within the IRF2 promoter, and expression of the IRF2 gene was affected by both transient and stable IRF1 expression. IRF2 competitively inhibits the IRF1-mediated transcriptional activation of interferons alpha and beta, and presumably other genes that employ IRF1 for transcription activation. However, IRF2 also functions as a transcriptional activator of histone H4. Irf2 was required to prevent NK-cell apoptosis and keep immature NK cells alive, thus promoting NK-cell maturation and their supply to peripheral blood.
Synonyms: DKFZp686F0244 antibody|Interferon regulatory factor 2 antibody|IRF 2 antibody|IRF-2 antibody|IRF2 antibody|IRF2_HUMAN antibody - Gen-ID
- 3660
- UniProt
- P14316
-