SP5 Antikörper (Middle Region)

Produktnummer ABIN3042490

Produktdetails anti-SP5 Antikörper

Target: SP5 (Sp5 Transcription Factor (SP5))

Bindungsspezifität: AA 246-275, Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SP5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Transcription factor Sp5(SP5) detection. Tested with WB, IHC-P in Human.

Sequenz: DFAQYQSQIA ALLQTKAPLA ATARRCRRCR

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Transcription factor Sp5(SP5) detection. Tested with WB, IHC-P in Human.
Gene Name: Sp5 transcription factor
Protein Name: Transcription factor Sp5

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Sp5 (246-275aa DFAQYQSQIAALLQTKAPLAATARRCRRCR), identical to the related mouse sequence.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, The detection limit for Sp5 is approximately 0.1 ng/lane under reducing conditions.
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu SP5

Target: SP5 (Sp5 Transcription Factor (SP5))

Andere Bezeichnung: SP5 (SP5 Produkte)

Synonyme: bts1 antikoerper, fc39b01 antikoerper, wu:fc39b01 antikoerper, Bricd6 antikoerper, SP-C antikoerper, SP5 antikoerper, SPC antikoerper, Sftp-2 antikoerper, Sftp2 antikoerper, pro-SpC antikoerper, Sp5 transcription factor antikoerper, Sp5 transcription factor a antikoerper, surfactant associated protein C antikoerper, trans-acting transcription factor 5 antikoerper, Sp5 antikoerper, sp5a antikoerper, SP5 antikoerper, CpipJ_CPIJ003609 antikoerper, Sftpc antikoerper

Hintergrund: Sp5 is mapped to 2q31.1. It is a member of the Sp family of zinc finger transcription factors. Like other family members, the Sp5 protein contains a Cys2His2 zinc finger DNA binding domain at the C-terminus. Elevated expression of Sp5 has been noted in several human tumors including hepatocellular carcinoma, gastric cancer and colon cancer.

Synonyms: Transcription factor Sp5 antibody

Gen-ID: 389058