CPT1B Antikörper (N-Term)

Produktnummer ABIN3042757

Produktdetails anti-CPT1B Antikörper

Target: CPT1B (Carnitine Palmitoyltransferase 1B (Muscle) (CPT1B))

Bindungsspezifität: AA 197-226, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CPT1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Carnitine O-palmitoyltransferase 1, muscle isoform (CPT1B) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: DDEEYYRMEL LAKEFQDKTA PRLQKYLVLK

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Carnitine O-palmitoyltransferase 1, muscle isoform (CPT1B) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: carnitine palmitoyltransferase 1B (muscle)
Protein Name: Carnitine O-palmitoyltransferase 1, muscle isoform

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CPT1B (197-226aa DDEEYYRMELLAKEFQDKTAPRLQKYLVLK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu CPT1B

Target: CPT1B (Carnitine Palmitoyltransferase 1B (Muscle) (CPT1B))

Andere Bezeichnung: CPT1B (CPT1B Produkte)

Synonyme: CPT1-M antikoerper, CPT1M antikoerper, CPTI antikoerper, CPTI-M antikoerper, M-CPT1 antikoerper, MCCPT1 antikoerper, MCPT1 antikoerper, CPT-IB antikoerper, M-CPTI antikoerper, CPT1 antikoerper, CPTIB antikoerper, cpt1al antikoerper, zgc:103709 antikoerper, CPT1B antikoerper, MGC147544 antikoerper, Cpt1 antikoerper, Cpt1-m antikoerper, Cpti antikoerper, Cpti-m antikoerper, M-cpti antikoerper, carnitine palmitoyltransferase 1B antikoerper, carnitine palmitoyltransferase 1B (muscle) antikoerper, carnitine palmitoyltransferase 1B L homeolog antikoerper, carnitine palmitoyltransferase 1b, muscle antikoerper, CPT1B antikoerper, Cpt1b antikoerper, cpt1b antikoerper, cpt1b.L antikoerper

Hintergrund: CPT1B is located on 22q13.33. The protein encoded by this gene, a member of the carnitine/ choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variants encoding different isoforms have been found for this gene, and read-through transcripts are expressed from the upstream locus that include exons from this gene.

Synonyms: muscle isoform antibody|Carnitine O palmitoyltransferase I mitochondrial muscle isoform antibody|Carnitine O palmitoyltransferase I muscle isoform antibody|Carnitine O-palmitoyl transferase 1, muscle isoform antibody|Carnitine O-palmitoyltransferase I antibody| Carnitine palmitoyltransferase 1A (muscle) antibody|Carnitine palmitoyltransferase 1B (muscle) antibody|Carnitine palmitoyltransferase 1B antibody|Carnitine palmitoyltransferase I like protein antibody|Carnitine palmitoyltransferase I muscle antibody|Carnitine palmitoyltransferase I-like protein antibody|CPT 1B antibody|CPT I antibody|CPT1 M antibody|CPT1 muscle antibody|CPT1-M antibody|Cpt1b antibody|CPT1B_HUMAN antibody|CPT1M antibody|CPTI antibody|CPTI M antibody|CPTI muscle antibody|CPTI-M antibody|CPTIM antibody| FLJ55729 antibody|FLJ58750 antibody|KIAA1670 antibody|M CPT1 antibody|M-CPT1 antibody| MCCPT1 antibody|MCPT1 antibody|muscle isoform antibody

Gen-ID: 1375

UniProt: Q92523

Pathways: AMPK Signaling, Monocarboxylic Acid Catabolic Process