CSNK1A1 Antikörper (N-Term)
-
- Target Alle CSNK1A1 Antikörper anzeigen
- CSNK1A1 (Casein Kinase 1, alpha 1 (CSNK1A1))
-
Bindungsspezifität
- AA 30-68, N-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CSNK1A1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Casein kinase I isoform alpha(CSNK1A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- DIYLAINITN GEEVAVKLES QKARHPQLLY ESKLYKILQ
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Casein kinase I isoform alpha(CSNK1A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: casein kinase 1, alpha 1
Protein Name: Casein kinase I isoform alpha - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human CSNK1A1 (30-68aa DIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQ), identical to the related mouse and rat sequences.
- Isotyp
- IgG
- Top Product
- Discover our top product CSNK1A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- CSNK1A1 (Casein Kinase 1, alpha 1 (CSNK1A1))
- Andere Bezeichnung
- CSNK1A1 (CSNK1A1 Produkte)
- Hintergrund
-
Casein kinase I isoform alpha is an enzyme that in humans is encoded by the CSNK1A1 gene. The CSNK1A1 gene is mapped to chromosome 5q32 based on an alignment of the CSNK1A1 sequence with the genomic sequence (GRCh37). It is reported that both screens identified CK1-alpha as a bifunctional regulator of NF-kappa-B. CK1-alpha dynamically associates with the CBM complex on T cell receptor engagement to participate in cytokine production and lymphocyte proliferation. However, CK1-alpha kinase activity has a contrasting role by subsequently promoting the phosphorylation and inactivation of CARMA1. CK1-alpha has thus a dual 'gating' function which first promotes and then terminates receptor-induced NF-kappa-B. ABC DLBCL cells required CK1-alpha for constitutive NF-kappa-B activity, indicating that CK1-alpha functions as a conditionally essential malignancy gene.
Synonyms: Casein kinase 1 alpha 1 antibody|Casein kinase I isoform alpha antibody|CK1 antibody|CK1A antibody|CKI alpha antibody|CKI-alpha antibody|CKIa antibody|Clock regulator kinase antibody|Csnk1a1 antibody|Down regulated in lung cancer antibody|HLCDGP1 antibody| KC1A_HUMAN antibody|PRO2975 antibody - Gen-ID
- 1452
- UniProt
- P48729
- Pathways
- WNT Signalweg, Hedgehog Signalweg
-