Integrin Alpha2b Antikörper (C-Term)
-
- Target Alle Integrin Alpha2b (CD41) Antikörper anzeigen
- Integrin Alpha2b (CD41)
-
Bindungsspezifität
- AA 677-711, C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Integrin Alpha2b Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Integrin alpha-Iib(ITGA2B) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- EAELAVHLPQ GAHYMRALSN VEGFERLICN QKKEN
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Integrin alpha-Iib(ITGA2B) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)
Protein Name: Integrin alpha-Iib - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human ITGA2B (677-711aa EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN), different from the related mouse sequence by four amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product CD41 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- Integrin Alpha2b (CD41)
- Andere Bezeichnung
- ITGA2B (CD41 Produkte)
- Synonyme
- AI172977 antikoerper, CD41 antikoerper, CD41B antikoerper, GpIIb antikoerper, alphaIIb antikoerper, BDPLT16 antikoerper, BDPLT2 antikoerper, GP2B antikoerper, GPIIb antikoerper, GT antikoerper, GTA antikoerper, HPA3 antikoerper, integrin alpha 2b antikoerper, integrin subunit alpha 2b antikoerper, Itga2b antikoerper, ITGA2B antikoerper
- Hintergrund
-
Integrin alpha-IIb is a protein that in humans is encoded by the ITGA2B gene. It is mapped to 17q21.32. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 2b undergoes post-translational cleavage to yield disulfide-linked light and heavy chains that join with beta 3 to form a fibrinogen receptor expressed in platelets that plays a crucial role in coagulation. Mutations that interfere with this role result in thrombasthenia. In addition to adhesion, integrins are known to participate in cell-surface mediated signalling.
Synonyms: antigen CD41 antibody|BDPLT16 antibody|BDPLT2 antibody|CD41 antibody|CD41B antibody|form 2 antibody|GP2B antibody|GPalpha IIb antibody|GPIIb antibody|GT antibody|GTA antibody|HPA3 antibody|Integrin alpha 2b antibody|Integrin alpha IIb antibody|Integrin alpha-IIb light chain antibody|Integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) antibody|ITA2B_HUMAN antibody|ITGA2B antibody|ITGAB antibody|platelet fibrinogen receptor, alpha subunit antibody|platelet glycoprotein IIb of IIb/IIIa complex antibody|Platelet membrane glycoprotein IIb antibody|platelet specific antigen BAK antibody - Gen-ID
- 3674
- UniProt
- P08514
- Pathways
- Integrin Complex
-