NDRG2 Antikörper (C-Term)
-
- Target Alle NDRG2 Antikörper anzeigen
- NDRG2 (NDRG Family Member 2 (NDRG2))
-
Bindungsspezifität
- AA 210-247, C-Term
-
Reaktivität
- Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NDRG2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Protein NDRG2(NDRG2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- NSELIQKYRN IITHAPNLDN IELYWNSYNN RRDLNFER
- Kreuzreaktivität (Details)
-
Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities. - Produktmerkmale
-
Rabbit IgG polyclonal antibody for Protein NDRG2(NDRG2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: NDRG family member 2
Protein Name: Protein NDRG2 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human NDRG2 (210-247aa NSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFER), different from the related mouse and rat sequences by three amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product NDRG2 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Variation of NDRG2 and c-Myc expression in rat heart during the acute stage of ischemia/reperfusion injury." in: Histochemistry and cell biology, Vol. 135, Issue 1, pp. 27-35, (2011) (PubMed).
: "
-
Variation of NDRG2 and c-Myc expression in rat heart during the acute stage of ischemia/reperfusion injury." in: Histochemistry and cell biology, Vol. 135, Issue 1, pp. 27-35, (2011) (PubMed).
-
- Target
- NDRG2 (NDRG Family Member 2 (NDRG2))
- Andere Bezeichnung
- NDRG2 (NDRG2 Produkte)
- Synonyme
- NDRG2 antikoerper, AI182517 antikoerper, AU040374 antikoerper, Ndr2 antikoerper, SYLD antikoerper, im:6909381 antikoerper, si:dkey-88n24.1 antikoerper, zgc:101847 antikoerper, NDRG family member 2 antikoerper, N-myc downstream regulated gene 2 antikoerper, NDRG family member 2 S homeolog antikoerper, ndrg2 antikoerper, NDRG2 antikoerper, Ndrg2 antikoerper, ndrg2.S antikoerper
- Hintergrund
-
Protein NDRG2, also known as KIAA1248, is a protein that in humans is encoded by the NDRG2 gene. It is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. This gene is mapped to 14q11.2. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. It contributes to the regulation of the WNT signaling pathway. Also, this gene may be involved in dendritic cell and neuron differentiation.
Synonyms: Antidepressant related protein ADRG123 antibody|Cytoplasmic protein Ndr1 antibody|DKFZp781G1938 antibody|FLJ25522 antibody|KIAA1248 antibody|N myc downstream regulated gene 2 antibody|N myc downstream regulator 2 antibody|NDR1 related protein NDR2 antibody|NDRG 2 antibody|NDRG family member 2 antibody|NDRG1 related protein antibody|NDRG2 antibody|NDRG2_HUMAN antibody|Protein NDRG2 antibody| Protein Syld709613 antibody|SYLD antibody|Syld709613 protein antibody - Gen-ID
- 57447
-