Leptin Antikörper (Middle Region)
-
- Target Alle Leptin (LEP) Antikörper anzeigen
- Leptin (LEP)
-
Bindungsspezifität
- AA 74-109, Middle Region
-
Reaktivität
- Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Leptin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), ELISA
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Leptin(LEP) detection. Tested with WB, ELISA in Mouse.
- Sequenz
- KMDQTLAVYQ QVLTSLPSQN VLQIANDLEN LRDLLH
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Leptin(LEP) detection. Tested with WB, ELISA in Mouse.
Gene Name: leptin
Protein Name: Leptin - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of mouse Leptin (74-109aa KMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLH), different from the related human sequence by five amino acids, and from the related rat sequence by two amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product LEP Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
lncRNA Ftx promotes aerobic glycolysis and tumor progression through the PPARγ pathway in hepatocellular carcinoma." in: International journal of oncology, Vol. 53, Issue 2, pp. 551-566, (2018) (PubMed).
: "A Triterpenoid Inhibited Hormone-Induced Adipocyte Differentiation and Alleviated Dexamethasone-Induced Insulin Resistance in 3T3-L1 adipocytes." in: Natural products and bioprospecting, Vol. 5, Issue 3, pp. 159-66, (2015) (PubMed).
: "Leptin induces cell proliferation and reduces cell apoptosis by activating c-myc in cervical cancer." in: Oncology reports, Vol. 29, Issue 6, pp. 2291-6, (2013) (PubMed).
: "Testis dysfunction by isoproterenol is mediated by upregulating endothelin receptor A, leptin and protein kinase Cvarepsilon and is attenuated by an endothelin receptor antagonist CPU0213." in: Reproductive toxicology (Elmsford, N.Y.), Vol. 29, Issue 4, pp. 421-6, (2010) (PubMed).
: "
-
lncRNA Ftx promotes aerobic glycolysis and tumor progression through the PPARγ pathway in hepatocellular carcinoma." in: International journal of oncology, Vol. 53, Issue 2, pp. 551-566, (2018) (PubMed).
-
- Target
- Leptin (LEP)
- Andere Bezeichnung
- LEP (LEP Produkte)
- Synonyme
- ob antikoerper, obese antikoerper, LEPD antikoerper, OB antikoerper, OBS antikoerper, leptin antikoerper, Lep antikoerper, LEP antikoerper, lep antikoerper
- Hintergrund
-
Leptin is a protein product of the mouse obese gene. Mice with mutations in the obese gene that block the synthesis of Leptin have been found to be obese and diabetic and to have reduced activity, metabolism and body temperature. cDNA clones encoding Leptin have been isolated from human, simian, mouse, and rat cells. The expression of Leptin mRNA has been shown to be restricted to adipose tissue. Although regulation of fat stores is deemed to be the primary function of leptin, it also plays a role in other physiological processes, as evidenced by its multiple sites of synthesis other than fat cells, and the multiple cell types beside hypothalamic cells that have leptin receptors. Many of these additional functions are yet to be defined.
Synonyms: FLJ94114 antibody|LEP antibody|LEP_HUMAN antibody|LEPD antibody|Leptin (murine obesity homolog) antibody|Leptin (obesity homolog, mouse) antibody|Leptin antibody|Leptin Murine Obesity Homolog antibody|Leptin Precursor Obesity Factor antibody|OB antibody|Obese Protein antibody|Obese, mouse, homolog of antibody|Obesity antibody|Obesity factor antibody|Obesity factor antibody|Obesity homolog mouse antibody|Obesity Murine Homolog Leptin antibody|OBS antibody|OTTHUMP00000212285 antibody - Gen-ID
- 16846
- UniProt
- P41160
- Pathways
- JAK-STAT Signalweg, AMPK Signaling, Hormone Transport, Peptide Hormone Metabolism, Hormone Activity, Negative Regulation of Hormone Secretion, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Monocarboxylic Acid Catabolic Process
-