c-Rel Antikörper (Middle Region)

Produktnummer ABIN3043314

Produktdetails anti-c-Rel Antikörper

Target: c-Rel (REL proto-oncogene (c-Rel))

Bindungsspezifität: AA 268-306, Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser c-Rel Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Proto-oncogene c-Rel(REL) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: DQEVSESMDF RYLPDEKDAY GNKSKKQKTT LIFQKLLQD

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Proto-oncogene c-Rel(REL) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: v-rel avian reticuloendotheliosis viral oncogene homolog
Protein Name: Proto-oncogene c-Rel

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of mouse c-Rel (268-306aa DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD), different from the related human sequence by four amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu c-Rel

Target: c-Rel (REL proto-oncogene (c-Rel))

Andere Bezeichnung: REL (c-Rel Produkte)

Synonyme: C-Rel antikoerper, c-Rel antikoerper, NFkB antikoerper, c-rel antikoerper, zgc:100833 antikoerper, Xrel2 antikoerper, Xrel3 antikoerper, rel antikoerper, rel-A antikoerper, rel2 antikoerper, rel3 antikoerper, v-rel antikoerper, xrel antikoerper, REL proto-oncogene, NF-kB subunit antikoerper, reticuloendotheliosis oncogene antikoerper, RELA proto-oncogene, NF-kB subunit antikoerper, v-rel avian reticuloendotheliosis viral oncogene homolog antikoerper, v-rel avian reticuloendotheliosis viral oncogene homolog L homeolog antikoerper, ribonuclease A family member 2 pseudogene antikoerper, REL antikoerper, Rel antikoerper, Rela antikoerper, rel antikoerper, rel.L antikoerper, ECRP antikoerper

Hintergrund: The proto-oncogene c-Rel is a protein that in humans is encoded by the REL gene. This gene is mapped to chromosome 2p13-p12. The c-Rel protein is a member of the NF-κB family of transcription factors and contains a Rel homology domain (RHD) at its N-terminus and two C-terminal transactivation domains. c-Rel has an important role in B-cell survival and proliferation. The REL gene is amplified or mutated in several human B-cell lymphomas, including diffuse large B-cell lymphoma and Hodgkin's lymphoma.

Synonyms: Avian reticuloendotheliosis antibody|C REL antibody|C Rel protein antibody|c Rel proto oncogene protein antibody|Oncogene REL antibody|Oncogene REL avian reticuloendotheliosis antibody|Proto-oncogene c-Rel antibody|REL antibody|REL_HUMAN antibody|v rel avian reticuloendotheliosis viral oncogene homolog antibody|v rel reticuloendotheliosis viral oncogene homolog antibody|V rel reticuloendotheliosis viral oncogene homolog (avian) antibody

Gen-ID: 19696

UniProt: P15307