SECTM1 Antikörper (C-Term)

Produktnummer ABIN3043325

Produktdetails anti-SECTM1 Antikörper

Target: SECTM1 (Secreted and Transmembrane 1 (SECTM1))

Bindungsspezifität: AA 118-152, C-Term

Reaktivität: Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SECTM1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Secreted and transmembrane protein 1b(Sectm1b) detection. Tested with WB in Mouse.

Sequenz: KLHGFQAEFK NFNLTVNAAD RQKTEDLPVT KVPDK

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Secreted and transmembrane protein 1b(Sectm1b) detection. Tested with WB in Mouse.
Gene Name: secreted and transmembrane 1B
Protein Name: Secreted and transmembrane protein 1b

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse SECTM1 (118-152aa KLHGFQAEFKNFNLTVNAADRQKTEDLPVTKVPDK).

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu SECTM1

Target: SECTM1 (Secreted and Transmembrane 1 (SECTM1))

Andere Bezeichnung: SECTM1 (SECTM1 Produkte)

Synonyme: K12 antikoerper, secreted and transmembrane 1 antikoerper, SECTM1 antikoerper

Hintergrund: SECTM1B is also known as Sectm1 or K12. Secreted and transmembrane protein 1 is a protein that in humans is encoded by the SECTM1 gene. This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.

Synonyms: K12 antibody|K12 protein antibody|Protein K-12 antibody|Protein K12 antibody|SCTM1_HUMAN antibody|Secreted and transmembrane 1 antibody|Secreted and transmembrane protein 1 antibody|SECTM 1 antibody|SECTM1 antibody|Type 1a transmembrane protein antibody

Gen-ID: 58210