SECTM1 Antikörper (C-Term)
-
- Target Alle SECTM1 Antikörper anzeigen
- SECTM1 (Secreted and Transmembrane 1 (SECTM1))
-
Bindungsspezifität
- AA 118-152, C-Term
-
Reaktivität
- Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SECTM1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Secreted and transmembrane protein 1b(Sectm1b) detection. Tested with WB in Mouse.
- Sequenz
- KLHGFQAEFK NFNLTVNAAD RQKTEDLPVT KVPDK
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Secreted and transmembrane protein 1b(Sectm1b) detection. Tested with WB in Mouse.
Gene Name: secreted and transmembrane 1B
Protein Name: Secreted and transmembrane protein 1b - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of mouse SECTM1 (118-152aa KLHGFQAEFKNFNLTVNAADRQKTEDLPVTKVPDK).
- Isotyp
- IgG
- Top Product
- Discover our top product SECTM1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- SECTM1 (Secreted and Transmembrane 1 (SECTM1))
- Andere Bezeichnung
- SECTM1 (SECTM1 Produkte)
- Hintergrund
-
SECTM1B is also known as Sectm1 or K12. Secreted and transmembrane protein 1 is a protein that in humans is encoded by the SECTM1 gene. This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.
Synonyms: K12 antibody|K12 protein antibody|Protein K-12 antibody|Protein K12 antibody|SCTM1_HUMAN antibody|Secreted and transmembrane 1 antibody|Secreted and transmembrane protein 1 antibody|SECTM 1 antibody|SECTM1 antibody|Type 1a transmembrane protein antibody - Gen-ID
- 58210
-