SOX5 Antikörper (C-Term)

Produktnummer ABIN3043348

Produktdetails anti-SOX5 Antikörper

Target: SOX5 (SRY (Sex Determining Region Y)-Box 5 (SOX5))

Bindungsspezifität: AA 495-528, C-Term

Reaktivität: Human, Ratte, Maus, Schwein

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SOX5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Transcription factor SOX-5(SOX5) detection. Tested with WB in Human,Mouse,Rat,Pig.

Sequenz: EKEKTTLESL TQQLAVKQNE EGKFSHAMMD FNLS

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Transcription factor SOX-5(SOX5) detection. Tested with WB in Human,Mouse,Rat,Pig.
Gene Name: SRY (sex determining region Y)-box 5
Protein Name: Transcription factor SOX-5

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SOX5 (495-528aa EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS), different from the related mouse sequence by two amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat, Pig
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu SOX5

Target: SOX5 (SRY (Sex Determining Region Y)-Box 5 (SOX5))

Andere Bezeichnung: SOX5 (SOX5 Produkte)

Synonyme: L-SOX5 antikoerper, XSox-5 antikoerper, l-sox5 antikoerper, A730017D01Rik antikoerper, AI528773 antikoerper, Sox5l1 antikoerper, xSox5 antikoerper, id:ibd5067 antikoerper, sb:eu456 antikoerper, si:dkey-215a8.1 antikoerper, SRY-box 5 antikoerper, SRY (sex determining region Y)-box 5 antikoerper, SRY box 5 antikoerper, SRY-box 5 S homeolog antikoerper, SOX5 antikoerper, sox5 antikoerper, Sox5 antikoerper, sox5.S antikoerper

Hintergrund: Transcription factor SOX-5 is a protein that in humans is encoded by the SOX5 gene. It is located on 12p12.1. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. In addition, the encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8. Multiple transcript variants encoding distinct isoforms have been identified for this gene.

Synonyms: L SOX5 antibody|MGC35153 antibody|Sex determining region Y box 5 antibody|SOX 5 antibody| SOX 5 protein antibody|Sox5 antibody|SOX5 protein antibody|SOX5_HUMAN antibody|SRY (sex determining region Y) box 5 antibody|SRY box 5 antibody|Transcription factor SOX 5 antibody|Transcription factor SOX-5 antibody|Transcription factor SOX5 antibody

Gen-ID: 6660

UniProt: P35711