RAB18 Antikörper (C-Term)
-
- Target Alle RAB18 Antikörper anzeigen
- RAB18 (RAB18, Member RAS Oncogene Family (RAB18))
-
Bindungsspezifität
- AA 156-192, C-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RAB18 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Ras-related protein Rab-18(RAB18) detection. Tested with WB in Human,Rat.
- Sequenz
- DGVQCAFEEL VEKIIQTPGL WESENQNKGV KLSHREE
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Ras-related protein Rab-18(RAB18) detection. Tested with WB in Human,Rat.
Gene Name: RAB18, member RAS oncogene family
Protein Name: Ras-related protein Rab-18 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human Rab18 (156-192aa DGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREE), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
- Isotyp
- IgG
- Top Product
- Discover our top product RAB18 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- RAB18 (RAB18, Member RAS Oncogene Family (RAB18))
- Andere Bezeichnung
- RAB18 (RAB18 Produkte)
- Hintergrund
-
Ras-related protein Rab-18 is a protein that in humans is encoded by the RAB18 gene. It is a ubiquitously expressed protein with particularly high expression in the brain. The protein encoded by this gene is a member of a family of Ras-related small GTPases that regulate membrane trafficking in organelles and transport vesicles. Knockdown studies in zebrafish suggest that this protein may have a role in eye and brain development. Mutations in this gene are associated with Warburg micro syndrome type 3. Alternatively spliced transcript variants have been found for this gene.
Synonyms: AA959686 antibody|RAB18 antibody|RAB18 small GTPase antibody|RAB18, member RAS oncogene family antibody|RAB18_HUMAN antibody|RAB18LI1 antibody|Ras related protein Rab 18 antibody|Ras-asssociated protein RAB18 antibody|Ras-related protein Rab-18 antibody|RP11-148B2.1 antibody|WARBM3 antibody - Gen-ID
- 22931
- Pathways
- SARS-CoV-2 Protein Interaktom
-