RAB18 Antikörper (C-Term)

Produktnummer ABIN3043365

Produktdetails anti-RAB18 Antikörper

Target: RAB18 (RAB18, Member RAS Oncogene Family (RAB18))

Bindungsspezifität: AA 156-192, C-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAB18 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Ras-related protein Rab-18(RAB18) detection. Tested with WB in Human,Rat.

Sequenz: DGVQCAFEEL VEKIIQTPGL WESENQNKGV KLSHREE

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Ras-related protein Rab-18(RAB18) detection. Tested with WB in Human,Rat.
Gene Name: RAB18, member RAS oncogene family
Protein Name: Ras-related protein Rab-18

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Rab18 (156-192aa DGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREE), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu RAB18

Target: RAB18 (RAB18, Member RAS Oncogene Family (RAB18))

Andere Bezeichnung: RAB18 (RAB18 Produkte)

Synonyme: RAB18LI1 antikoerper, WARBM3 antikoerper, AA959686 antikoerper, RAB18 antikoerper, rab18li1 antikoerper, LOC100219058 antikoerper, rab18 antikoerper, zgc:92523 antikoerper, fc62e07 antikoerper, wu:fc62e07 antikoerper, zgc:77145 antikoerper, RAB18, member RAS oncogene family antikoerper, ras-related protein Rab-18-B antikoerper, ras-related protein Rab-18-like antikoerper, Ras-related protein Rab-18 antikoerper, RAB18, member RAS oncogene family S homeolog antikoerper, RAB18B, member RAS oncogene family antikoerper, RAB18A, member RAS oncogene family antikoerper, RAB18 antikoerper, Rab18 antikoerper, rab18 antikoerper, LOC100219058 antikoerper, rab-18 antikoerper, rab18.S antikoerper, rab18b antikoerper, rab18a antikoerper

Hintergrund: Ras-related protein Rab-18 is a protein that in humans is encoded by the RAB18 gene. It is a ubiquitously expressed protein with particularly high expression in the brain. The protein encoded by this gene is a member of a family of Ras-related small GTPases that regulate membrane trafficking in organelles and transport vesicles. Knockdown studies in zebrafish suggest that this protein may have a role in eye and brain development. Mutations in this gene are associated with Warburg micro syndrome type 3. Alternatively spliced transcript variants have been found for this gene.

Synonyms: AA959686 antibody|RAB18 antibody|RAB18 small GTPase antibody|RAB18, member RAS oncogene family antibody|RAB18_HUMAN antibody|RAB18LI1 antibody|Ras related protein Rab 18 antibody|Ras-asssociated protein RAB18 antibody|Ras-related protein Rab-18 antibody|RP11-148B2.1 antibody|WARBM3 antibody

Gen-ID: 22931

Pathways: SARS-CoV-2 Protein Interaktom