STXBP1 Antikörper (N-Term)

Produktnummer ABIN3043413

Produktdetails anti-STXBP1 Antikörper

Target: STXBP1 (Syntaxin Binding Protein 1 (STXBP1))

Bindungsspezifität: AA 184-216, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STXBP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Syntaxin-binding protein 1(STXBP1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: KEYPAVRYRG EYKDNALLAQ LIQDKLDAYK ADD

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Syntaxin-binding protein 1(STXBP1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: syntaxin binding protein 1
Protein Name: Syntaxin-binding protein 1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Munc18-1 (184-216aa KEYPAVRYRGEYKDNALLAQLIQDKLDAYKADD), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu STXBP1

Target: STXBP1 (Syntaxin Binding Protein 1 (STXBP1))

Andere Bezeichnung: STXBP1 (STXBP1 Produkte)

Hintergrund: Syntaxin-binding protein 1, also known as Munc18-1, is a protein that in humans is encoded by the STXBP1 gene. By fluorescence in situ hybridization, the STXBP1 gene is mapped to chromosome 9q34.1. This gene encodes a syntaxin-binding protein. The encoded protein appears to play a role in release of neurotransmitters via regulation of syntaxin, a transmembrane attachment protein receptor. Mutations in this gene have been associated with infantile epileptic encephalopathy-4. Alternatively spliced transcript variants have been described.

Synonyms: FLJ37475 antibody|Munc 18 1 antibody|Munc 18a antibody|MUNC18 1 antibody|N-Sec1 antibody|Neuronal SEC1 antibody|NSec1 antibody|p67 antibody|Protein unc-18 homolog 1 antibody|Protein unc-18 homolog A antibody|Rb sec1 antibody|RBSEC1 antibody|STXB1_HUMAN antibody| STXBP1 antibody|Syntaxin binding protein 1 antibody|Syntaxin-binding protein 1 antibody|Unc 18 homolog antibody|Unc 18A antibody|Unc-18A antibody|Unc18 1 antibody|UNC18 antibody|Unc18-1 antibody

Gen-ID: 6812

UniProt: P61764

Pathways: Synaptic Vesicle Exocytosis, Dicarboxylic Acid Transport