Transferrin Antikörper (N-Term)
-
- Target Alle Transferrin (TF) Antikörper anzeigen
- Transferrin (TF)
-
Bindungsspezifität
- AA 20-49, N-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Transferrin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Serotransferrin(TF) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- VPDKTVRWCA VSEHEATKCQ SFRDHMKSVI
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Serotransferrin(TF) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: transferrin
Protein Name: Serotransferrin - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human Transferrin (20-49aa VPDKTVRWCAVSEHEATKCQSFRDHMKSVI), different from the related mouse and rat sequences by five amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product TF Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
MCPIP is induced by cholesterol and participated in cholesterol-caused DNA damage in HUVEC." in: International journal of clinical and experimental pathology, Vol. 8, Issue 9, pp. 10625-34, (2016) (PubMed).
: "Effect Comparison of Both Iron Chelators on Outcomes, Iron Deposit, and Iron Transporters After Intracerebral Hemorrhage in Rats." in: Molecular neurobiology, (2015) (PubMed).
: "A study of the ultrasound-targeted microbubble destruction based triplex-forming oligodexinucleotide delivery system to inhibit tissue factor expression." in: Molecular medicine reports, Vol. 11, Issue 2, pp. 903-9, (2014) (PubMed).
: "Co-expression of CD133, CD44v6 and human tissue factor is associated with metastasis and poor prognosis in pancreatic carcinoma." in: Oncology reports, Vol. 32, Issue 2, pp. 755-63, (2014) (PubMed).
: "Protective effect and mechanism of sodium tanshinone II A sulfonate on microcirculatory disturbance of small intestine in rats with sepsis." in: Journal of Huazhong University of Science and Technology. Medical sciences = Hua zhong ke ji da xue xue bao. Yi xue Ying De wen ban = Huazhong keji daxue xuebao. Yixue Yingdewen ban, Vol. 31, Issue 4, pp. 441-5, (2011) (PubMed).
: "Immunolocalisation of tissue factor in esophageal cancer is correlated with intratumoral angiogenesis and prognosis of the patient." in: Acta histochemica, Vol. 112, Issue 3, pp. 233-9, (2010) (PubMed).
: "
-
MCPIP is induced by cholesterol and participated in cholesterol-caused DNA damage in HUVEC." in: International journal of clinical and experimental pathology, Vol. 8, Issue 9, pp. 10625-34, (2016) (PubMed).
-
- Target
- Transferrin (TF)
- Andere Bezeichnung
- Transferrin (TF Produkte)
- Hintergrund
-
Transferrins are iron-binding blood plasma glycoproteins that control the level of free iron in biological fluids. In humans, it is encoded by the TF gene. Transferrin consists of a polypeptide chain containing 679 amino acids in humans. The protein is composed of alpha helices and beta sheets to form two domains. The N- and C- terminal sequences are represented by globular lobes and between the two lobes is an iron-binding site. Transferrin is a glycoprotein that binds iron very tightly but reversibly. Although iron bound to transferrin is less than 0.1 % (4 mg) of the total body iron, it is the most important iron pool, with the highest rate of turnover (25 mg/24 h). And Transferrin has a molecular weight of around 80 kDa and contains 2 specific high-affinity Fe(III) binding sites. The affinity of transferrin for Fe(III) is extremely high (1023 M-1 at pH 7.4) but decreases progressively with decreasing pH below neutrality.
Synonyms: Apotransferrin antibody|Beta 1 metal binding globulin antibody|Beta-1 metal-binding globulin antibody|DKFZp781D0156 antibody|PRO1400 antibody|PRO1557 antibody|PRO2086 antibody|Serotransferrin antibody|Serotransferrin precursor antibody|Siderophilin antibody|TF antibody|TFQTL1 antibody|Transferin antibody|Transferrin antibody - Gen-ID
- 7018
- UniProt
- P02787
- Pathways
- Transition Metal Ion Homeostasis
-