Transferrin Antikörper (N-Term)

Produktnummer ABIN3043419

Produktdetails anti-Transferrin Antikörper

Target: Transferrin (TF)

Bindungsspezifität: AA 20-49, N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Transferrin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Serotransferrin(TF) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: VPDKTVRWCA VSEHEATKCQ SFRDHMKSVI

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Serotransferrin(TF) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: transferrin
Protein Name: Serotransferrin

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Transferrin (20-49aa VPDKTVRWCAVSEHEATKCQSFRDHMKSVI), different from the related mouse and rat sequences by five amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-Transferrin Antikörper (ABIN3043419)

Da, Zhuo, Qian: "MCPIP is induced by cholesterol and participated in cholesterol-caused DNA damage in HUVEC." in: International journal of clinical and experimental pathology, Vol. 8, Issue 9, pp. 10625-34, (2016) (PubMed).

Wang, Hu, Tang, Wang, Sun, Chen, Yin, Xue, Sun: "Effect Comparison of Both Iron Chelators on Outcomes, Iron Deposit, and Iron Transporters After Intracerebral Hemorrhage in Rats." in: Molecular neurobiology, (2015) (PubMed).

Liang, Zhang, Zhao, Li, Yang, Liang, Ceng: "A study of the ultrasound-targeted microbubble destruction based triplex-forming oligodexinucleotide delivery system to inhibit tissue factor expression." in: Molecular medicine reports, Vol. 11, Issue 2, pp. 903-9, (2014) (PubMed).

Chen, Li, Jiang, Zhang, Zhang, Jiang, He, Li: "Co-expression of CD133, CD44v6 and human tissue factor is associated with metastasis and poor prognosis in pancreatic carcinoma." in: Oncology reports, Vol. 32, Issue 2, pp. 755-63, (2014) (PubMed).

Zhu, Lv, Chen, Wang, Zhong: "Protective effect and mechanism of sodium tanshinone II A sulfonate on microcirculatory disturbance of small intestine in rats with sepsis." in: Journal of Huazhong University of Science and Technology. Medical sciences = Hua zhong ke ji da xue xue bao. Yi xue Ying De wen ban = Huazhong keji daxue xuebao. Yixue Yingdewen ban, Vol. 31, Issue 4, pp. 441-5, (2011) (PubMed).

Chen, Luo, Tan, Wei, Wu, Zheng, Zhang, Xu: "Immunolocalisation of tissue factor in esophageal cancer is correlated with intratumoral angiogenesis and prognosis of the patient." in: Acta histochemica, Vol. 112, Issue 3, pp. 233-9, (2010) (PubMed).

Details zu Transferrin

Target: Transferrin (TF)

Andere Bezeichnung: Transferrin (TF Produkte)

Synonyme: ltf antikoerper, pro1557 antikoerper, pro2086 antikoerper, mgc107777 antikoerper, LOC692564 antikoerper, TF antikoerper, LOC100144362 antikoerper, tf antikoerper, LTF antikoerper, TFEW antikoerper, conalbumin antikoerper, tf-b antikoerper, MGC64306 antikoerper, PRO1557 antikoerper, PRO2086 antikoerper, TFQTL1 antikoerper, AI266983 antikoerper, Cd176 antikoerper, HP antikoerper, Tf antikoerper, Tfn antikoerper, hpx antikoerper, Trf antikoerper, cb285 antikoerper, gavi antikoerper, id:ibd3238 antikoerper, id:ibd3525 antikoerper, sb:cb285 antikoerper, wu:fb57g06 antikoerper, wu:fb62h02 antikoerper, wu:fb63h10 antikoerper, wu:fb64h10 antikoerper, zgc:112154 antikoerper, 143958_at antikoerper, CG6186 antikoerper, Dmel\\CG6186 antikoerper, TSF1 antikoerper, anon-EST:Posey265 antikoerper, tsf1 antikoerper, Pro-TRH antikoerper, IL-5 antikoerper, STF I antikoerper, TRF1 antikoerper, sTF1 antikoerper, sTf antikoerper, tf1 antikoerper, transferrin antikoerper, serotransferrin antikoerper, transferrin (ovotransferrin) antikoerper, transferrin L homeolog antikoerper, melanotransferrin antikoerper, transferrin-a antikoerper, Transferrin 1 antikoerper, thyrotropin releasing hormone antikoerper, interleukin 5 antikoerper, TF antikoerper, LOC477072 antikoerper, tf antikoerper, Tf antikoerper, LOC100144362 antikoerper, tf.L antikoerper, LOC5575625 antikoerper, Trf antikoerper, tfa antikoerper, Tsf1 antikoerper, TRH antikoerper, IL5 antikoerper, LOC101085148 antikoerper, LOC100726872 antikoerper, trf antikoerper

Hintergrund: Transferrins are iron-binding blood plasma glycoproteins that control the level of free iron in biological fluids. In humans, it is encoded by the TF gene. Transferrin consists of a polypeptide chain containing 679 amino acids in humans. The protein is composed of alpha helices and beta sheets to form two domains. The N- and C- terminal sequences are represented by globular lobes and between the two lobes is an iron-binding site. Transferrin is a glycoprotein that binds iron very tightly but reversibly. Although iron bound to transferrin is less than 0.1 % (4 mg) of the total body iron, it is the most important iron pool, with the highest rate of turnover (25 mg/24 h). And Transferrin has a molecular weight of around 80 kDa and contains 2 specific high-affinity Fe(III) binding sites. The affinity of transferrin for Fe(III) is extremely high (1023 M-1 at pH 7.4) but decreases progressively with decreasing pH below neutrality.

Synonyms: Apotransferrin antibody|Beta 1 metal binding globulin antibody|Beta-1 metal-binding globulin antibody|DKFZp781D0156 antibody|PRO1400 antibody|PRO1557 antibody|PRO2086 antibody|Serotransferrin antibody|Serotransferrin precursor antibody|Siderophilin antibody|TF antibody|TFQTL1 antibody|Transferin antibody|Transferrin antibody

Gen-ID: 7018

UniProt: P02787

Pathways: Transition Metal Ion Homeostasis