LYZ Antikörper (C-Term)

Produktnummer ABIN3043465

Produktdetails anti-LYZ Antikörper

Target: LYZ (Lysozyme (LYZ))

Bindungsspezifität: AA 106-141, C-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LYZ Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Lysozyme C(LYZ) detection. Tested with WB, IHC-P in Human,Rat.

Sequenz: NIADAVACAK RVVRDPQGIR AWVAWRNRCQ NRDVRQ

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Lysozyme C(LYZ) detection. Tested with WB, IHC-P in Human,Rat.
Gene Name: lysozyme
Protein Name: Lysozyme C

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Lysozyme (106-141aa NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ).

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-LYZ Antikörper (ABIN3043465)

Xu, Liu, Liu, Han, Zhang, Zhao: "Dynamic changes and mechanism of intestinal endotoxemia in partially hepatectomized rats." in: World journal of gastroenterology, Vol. 13, Issue 26, pp. 3592-7, (2007) (PubMed).

Details zu LYZ

Target: LYZ (Lysozyme (LYZ))

Andere Bezeichnung: LYZ (LYZ Produkte)

Synonyme: LZM antikoerper, 1 antikoerper, LYZC antikoerper, lys-C antikoerper, zgc:136734 antikoerper, BmLys antikoerper, LYS antikoerper, LZ antikoerper, LYZS antikoerper, lysozyme C antikoerper, LYZ antikoerper, lysozyme antikoerper, lysozyme antikoerper, lysozyme (renal amyloidosis) antikoerper, lysozyme L homeolog antikoerper, serum lysozyme antikoerper, LYZ antikoerper, lyz antikoerper, Lzm antikoerper, LOC781146 antikoerper, lyz.L antikoerper, S-LZ antikoerper

Hintergrund: In humans, the lysozyme enzyme is encoded by the LYZ gene. This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta [1-4] glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis.

Synonyms: 1 4 beta n acetylmuramidase c antibody|1 antibody|4-beta-N-acetylmuramidase C antibody|EC 3.2.1.17 antibody|LYSC_HUMAN antibody| Lysosyme antibody|Lysozyme (renal amyloidosis) antibody|Lysozyme C antibody|Lysozyme C precursor antibody|Lyz antibody|LZM antibody| Renal amyloidosis antibody

Gen-ID: 4069

UniProt: P61626