BMP4 Antikörper (C-Term)
-
- Target Alle BMP4 Antikörper anzeigen
- BMP4 (Bone Morphogenetic Protein 4 (BMP4))
-
Bindungsspezifität
- AA 293-324, C-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BMP4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), ELISA
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Bone morphogenetic protein 4(BMP4) detection. Tested with WB, ELISA in Human,Mouse.
- Sequenz
- SPKHHSQRAR KKNKNCRRHS LYVDFSDVGW ND
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Bone morphogenetic protein 4(BMP4) detection. Tested with WB, ELISA in Human,Mouse.
Gene Name: bone morphogenetic protein 4
Protein Name: Bone morphogenetic protein 4 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-4 (293-324aa SPKHHSQRARKKNKNCRRHSLYVDFSDVGWND), different from the related mouse and rat sequences by two amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product BMP4 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Form-deprivation myopia induces decreased expression of bone morphogenetic protein-2, 5 in guinea pig sclera." in: International journal of ophthalmology, Vol. 8, Issue 1, pp. 39-45, (2015) (PubMed).
: "Expansive effects of aorta-gonad-mesonephros-derived stromal cells on hematopoietic stem cells from embryonic stem cells." in: Chinese medical journal, Vol. 118, Issue 23, pp. 1979-86, (2005) (PubMed).
: "
-
Form-deprivation myopia induces decreased expression of bone morphogenetic protein-2, 5 in guinea pig sclera." in: International journal of ophthalmology, Vol. 8, Issue 1, pp. 39-45, (2015) (PubMed).
-
- Target
- BMP4 (Bone Morphogenetic Protein 4 (BMP4))
- Andere Bezeichnung
- BMP4 (BMP4 Produkte)
- Synonyme
- BMP2B antikoerper, BMP2B1 antikoerper, MCOPS6 antikoerper, OFC11 antikoerper, ZYME antikoerper, Bmp-4 antikoerper, Bmp2b antikoerper, Bmp2b-1 antikoerper, Bmp2b1 antikoerper, BOMPR4A antikoerper, bmp-4 antikoerper, zbmp-4 antikoerper, zgc:100779 antikoerper, BMP-4 antikoerper, XBMP-4 antikoerper, bmp2b antikoerper, bmp2b1 antikoerper, bmp4 antikoerper, ofc11 antikoerper, xbmp4 antikoerper, zyme antikoerper, BMP4 antikoerper, bone morphogenetic protein 4 antikoerper, bone morphogenetic protein 4 L homeolog antikoerper, bone morphogenetic protein 4 S homeolog antikoerper, BMP4 antikoerper, Bmp4 antikoerper, bmp4 antikoerper, bmp4.L antikoerper, bmp4.S antikoerper
- Hintergrund
-
Bone morphogenetic protein 4 is a protein that in humans is encoded by BMP4 gene. It is found on chromosome 14q22-q23. The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein.
Synonyms: BMP 2B antibody|BMP 4 antibody|BMP-2B antibody|BMP-4 antibody|BMP2B antibody|BMP2B1 antibody|BMP4 antibody|BMP4_HUMAN antibody|Bone morphogenetic protein 2B antibody|Bone morphogenetic protein 4 antibody|DVR4 antibody|MCOPS6 antibody|OFC11 antibody|ZYME antibody - Gen-ID
- 652
- UniProt
- P12644
- Pathways
- Steroid Hormone Mediated Signaling Pathway, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development
-