Parvin alpha Antikörper (Middle Region)

Produktnummer ABIN3043590

Produktdetails anti-Parvin alpha Antikörper

Target: Parvin alpha (PARVA) (Parvin, alpha (PARVA))

Bindungsspezifität: AA 155-185, Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Parvin alpha Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Alpha-parvin(PARVA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: QKLQTVLEKI NETLKLPPRS IKWNVDSVHA K

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Alpha-parvin(PARVA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: parvin, alpha
Protein Name: Alpha-parvin

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Parvin alpha (155-185aa QKLQTVLEKINETLKLPPRSIKWNVDSVHAK), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu Parvin alpha

Target: Parvin alpha (PARVA) (Parvin, alpha (PARVA))

Andere Bezeichnung: PARVA (PARVA Produkte)

Synonyme: CH-ILKBP antikoerper, MXRA2 antikoerper, Actp antikoerper, 2010012A22Rik antikoerper, 5430400F08Rik antikoerper, AI225929 antikoerper, AU042898 antikoerper, Parvin antikoerper, parva antikoerper, wu:fc59e06 antikoerper, zgc:101643 antikoerper, PARVA antikoerper, Parva antikoerper, parvin alpha antikoerper, parvin, alpha antikoerper, parvin, alpha a antikoerper, PARVA antikoerper, Parva antikoerper, parvaa antikoerper

Hintergrund: Parvin alpha is a protein that in humans is encoded by the PARVA gene. It is located on 11p15.3. PARVA belongs to the parvin family of actin-binding proteins. Parvins are associated with focal contacts and contain calponin homology domains that bind to actin filaments. The encoded protein is part of the integrin-linked kinase signaling complex and plays a role in cell adhesion, motility and survival.

Synonyms: Actopaxin antibody|Alpha parvin antibody|Alpha-parvin antibody|Calponin like integrin linked kinase binding protein antibody|Calponin-like integrin-linked kinase-binding protein antibody|CH ILKBP antibody|CH-ILKBP antibody|FLJ10793 antibody|FLJ12254 antibody|Matrix remodelling associated 2 antibody|Matrix remodelling associated protein 2 antibody|Matrix-remodeling-associated protein 2 antibody|MXRA 2 antibody|MXRA2 antibody|PARV A antibody| PARVA antibody|PARVA_HUMAN antibody

Gen-ID: 55742

Pathways: Smooth Muscle Cell Migration