PAX2A Antikörper (C-Term)

Produktnummer ABIN3043591

Produktdetails anti-PAX2A Antikörper

Target: PAX2A (Paired Box Gene 2a (PAX2A))

Bindungsspezifität: AA 248-282, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PAX2A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Paired box protein Pax-2(PAX2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: RKHLRADTFT QQQLEALDRV FERPSYPDVF QASEH

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Paired box protein Pax-2(PAX2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: paired box 2
Protein Name: Paired box protein Pax-2

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Pax2 (248-282aa RKHLRADTFTQQQLEALDRVFERPSYPDVFQASEH), identical to the related mouse sequence.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-PAX2A Antikörper (ABIN3043591)

Yang, He, Peng, Zhong, Deng, Yu, Guan, Zuo, Xu: "Matrine suppresses the migration and invasion of NSCLC cells by inhibiting PAX2-induced epithelial-mesenchymal transition." in: OncoTargets and therapy, Vol. 10, pp. 5209-5217, (2017) (PubMed).

Details zu PAX2A

Target: PAX2A (Paired Box Gene 2a (PAX2A))

Andere Bezeichnung: PAX2 (PAX2A Produkte)

Synonyme: PAPRS antikoerper, Opdc antikoerper, Pax-2 antikoerper, Pax-2a antikoerper, XPax-2 antikoerper, XPax2 antikoerper, pax-2 antikoerper, pax2 antikoerper, xPax-2a antikoerper, PAXZF-B antikoerper, cb378 antikoerper, noi antikoerper, pax-b antikoerper, pax2.1 antikoerper, pax2a1 antikoerper, pax[zf-b] antikoerper, paxb antikoerper, pax2.2 antikoerper, paired box 2 antikoerper, paired box 2 L homeolog antikoerper, paired box 2a antikoerper, paired box 2b antikoerper, PAX2 antikoerper, Pax2 antikoerper, pax2.L antikoerper, pax2a antikoerper, pax2b antikoerper

Hintergrund: Paired box gene 2, also known as PAX2, is a protein which in humans is encoded by the PAX2 gene. This gene is mapped to 10q24. PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor suppressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants.

Synonyms: Paired box 2 antibody|Paired box gene 2 antibody|paired box homeotic gene 2 antibody|paired box protein 2 antibody|Paired box protein Pax 2 antibody|Paired box protein Pax-2 antibody|Paired box protein Pax2 antibody|Pax 2 antibody

Gen-ID: 5076

UniProt: Q02962

Pathways: Carbohydrate Homeostasis, Stem Cell Maintenance, Tube Formation