PDPK1 Antikörper (C-Term)
-
- Target Alle PDPK1 Antikörper anzeigen
- PDPK1 (3-phosphoinositide Dependent Protein Kinase-1 (PDPK1))
-
Bindungsspezifität
- AA 524-556, C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PDPK1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for 3-phosphoinositide-dependent protein kinase 1(PDPK1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- YLMDPSGNAH KWCRKIQEVW RQRYQSHPDA AVQ
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for 3-phosphoinositide-dependent protein kinase 1(PDPK1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: 3-phosphoinositide dependent protein kinase 1
Protein Name: 3-phosphoinositide-dependent protein kinase 1 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human PDPK1 (524-556aa YLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ), different from the related mouse and rat sequences by two amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product PDPK1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- PDPK1 (3-phosphoinositide Dependent Protein Kinase-1 (PDPK1))
- Andere Bezeichnung
- PDPK1 (PDPK1 Produkte)
- Hintergrund
-
3-phosphoinositide dependent protein kinase-1, also known as PDPK1, is a protein which in humans is encoded by the PDPK1 gene. It is mapped to 16p13.3. PDPK1 is a master kinase, which is crucial for the activation of AKT/PKB and many other AGC kinases including PKC, S6K, SGK. An important role for PDPK1 is in the signalling pathways activated by several growth factors and hormones including insulin signaling. Mice lacking PDPK1 die during early embryonic development, indicating that this enzyme is critical for transmitting the growth-promoting signals necessary for normal mammalian development.
Synonyms: 3 phosphoinositide dependent protein kinase 1 antibody|3-phosphoinositide-dependent protein kinase 1 antibody|hPDK 1 antibody|hPDK1 antibody|MGC20087 antibody|MGC35290 antibody|OTTHUMP00000159109 antibody|OTTHUMP00000159110 antibody|OTTHUMP00000174525 antibody| PDK1 antibody|Pdpk1 antibody|PDPK1_HUMAN antibody|PDPK2 antibody|PkB kinase antibody|PkB kinase like gene 1 antibody|PkB like 1 antibody|PRO0461 antibody|Protein kinase antibody - Gen-ID
- 5170
- UniProt
- O15530
- Pathways
- PI3K-Akt Signalweg, T-Zell Rezeptor Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Cell-Cell Junction Organization, Regulation of Cell Size, Skeletal Muscle Fiber Development, CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, VEGFR1 Specific Signals
-