PKLR Antikörper (C-Term)
-
- Target Alle PKLR Antikörper anzeigen
- PKLR (Pyruvate Kinase, Liver and RBC (PKLR))
-
Bindungsspezifität
- AA 522-552, C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PKLR Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Pyruvate kinase PKLR(PKLR) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- EAIWADDVDR RVQFGIESGK LRGFLRVGDL V
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Pyruvate kinase PKLR(PKLR) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: pyruvate kinase, liver and RBC
Protein Name: Pyruvate kinase PKLR - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human PKLR (522-552aa EAIWADDVDRRVQFGIESGKLRGFLRVGDLV), different from the related mouse sequence by one amino acid, and identical to the rat sequence.
- Isotyp
- IgG
- Top Product
- Discover our top product PKLR Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- PKLR (Pyruvate Kinase, Liver and RBC (PKLR))
- Andere Bezeichnung
- PKLR (PKLR Produkte)
- Synonyme
- PK1 antikoerper, PKL antikoerper, PKR antikoerper, PKRL antikoerper, RPK antikoerper, Pklg antikoerper, wu:fd15e01 antikoerper, wu:fi37e08 antikoerper, pk1 antikoerper, PKLR antikoerper, Pk-1 antikoerper, Pk1 antikoerper, R-PK antikoerper, pklr antikoerper, pyruvate kinase L/R antikoerper, pyruvate kinase, liver and RBC antikoerper, pyruvate kinase, liver and RBC L homeolog antikoerper, pyruvate kinase liver and red blood cell antikoerper, pyruvate kinase PKLR-like antikoerper, PKLR antikoerper, Pklr antikoerper, pklr antikoerper, pklr.L antikoerper, LOC100621940 antikoerper
- Hintergrund
-
Pyruvate kinase isozymes R/L is an enzyme that in humans is encoded by the PKLR gene. It is mapped to 1q21. The protein encoded by this gene is a pyruvate kinase that catalyzes the transphosphorylation of phohsphoenolpyruvate into pyruvate and ATP, which is the rate-limiting step of glycolysis. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA). Multiple transcript variants encoding different isoforms have been found for this gene.
Synonyms: EC 2.7.1.40 antibody|KPYR_HUMAN antibody|L-PK antibody|Pk-1 antibody|PK1 antibody|PKL antibody|Pklg antibody|Pklr antibody|PKR antibody|PKRL antibody|Pyruvate kinase 1 antibody|Pyruvate kinase isozymes R/L antibody|Pyruvate kinase liver and blood cell antibody|Pyruvate kinase liver and RBC antibody|Pyruvate kinase liver and red blood cell antibody|Pyruvate kinase liver type antibody|Pyruvate kinase type L antibody|Pyruvate kinase, red cell type antibody|R type/L type pyruvate kinase antibody|R-PK antibody|R-type/L-type pyruvate kinase antibody|Red cell/liver pyruvate kinase antibody|RPK antibody - Gen-ID
- 5313
- UniProt
- P30613
- Pathways
- Ribonucleoside Biosynthetic Process
-