MAPK13 Antikörper (C-Term)

Produktnummer ABIN3043610

Produktdetails anti-MAPK13 Antikörper

Target: MAPK13 (Mitogen-Activated Protein Kinase 13 (MAPK13))

Bindungsspezifität: AA 332-365, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAPK13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Mitogen-activated protein kinase 13(MAPK13) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: KLTVDEWKQH IYKEIVNFSP IARKDSRRRS GMKL

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Mitogen-activated protein kinase 13(MAPK13) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: mitogen-activated protein kinase 13
Protein Name: Mitogen-activated protein kinase 13

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SAPK4 (332-365aa KLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu MAPK13

Target: MAPK13 (Mitogen-Activated Protein Kinase 13 (MAPK13))

Andere Bezeichnung: MAPK13 (MAPK13 Produkte)

Synonyme: F24B9.3 antikoerper, F24B9_3 antikoerper, MAPK 13 antikoerper, MAPK-13 antikoerper, PRKM13 antikoerper, SAPK4 antikoerper, p38delta antikoerper, Serk4 antikoerper, Prkm13 antikoerper, sapk4 antikoerper, prkm13 antikoerper, Protein kinase superfamily protein antikoerper, mitogen-activated protein kinase 13 antikoerper, mitogen activated protein kinase 13 antikoerper, ATMPK13 antikoerper, MAPK13 antikoerper, Mapk13 antikoerper, mapk13 antikoerper

Hintergrund: MAPK13 (Mitogen-Activated Protein Kinase 13), also called p38-DELTA or Stress-Activated Protein Kinase 4(SAPK4), is an enzyme that in humans is encoded by the MAPK13 gene. The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and cellular stress. MAP kinase kinases 3, and 6 can phosphorylate and activate this kinase. Transcription factor ATF2, and microtubule dynamics regulator stathmin have been shown to be the substrates of this kinase.

Synonyms: MAP kinase 13 antibody|MAP kinase p38 delta antibody|MAPK 13 antibody|MAPK-13 antibody| Mapk13 antibody|MGC99536 antibody|Mitogen activated protein kinase 13 antibody|Mitogen-activated protein kinase 13 antibody|Mitogen-activated protein kinase p38 delta antibody| MK13_HUMAN antibody|OTTHUMP00000016282 antibody|OTTHUMP00000016283 antibody|p38 delta antibody|P38delta antibody|PRKM13 antibody|SAPK 4 antibody|SAPK4 antibody|Stress activated protein kinase 4 antibody|Stress-activated protein kinase 4 antibody

Gen-ID: 5603

UniProt: O15264

Pathways: MAPK Signalweg, Neurotrophin Signalübertragung, Hepatitis C, BCR Signaling, S100 Proteine