HSPA2 Antikörper (C-Term)
-
- Target Alle HSPA2 Antikörper anzeigen
- HSPA2 (Heat Shock 70kDa Protein 2 (HSPA2))
-
Bindungsspezifität
- AA 564-598, C-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HSPA2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Heat shock-related 70 kDa protein 2(HSPA2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- KISEQDKNKI LDKCQEVINW LDRNQMAEKD EYEHK
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Heat shock-related 70 kDa protein 2(HSPA2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: heat shock 70 kDa protein 2
Protein Name: Heat shock-related 70 kDa protein 2 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human HSPA2 (564-598aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK), identical to the related mouse and rat sequences.
- Isotyp
- IgG
- Top Product
- Discover our top product HSPA2 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- HSPA2 (Heat Shock 70kDa Protein 2 (HSPA2))
- Andere Bezeichnung
- HSPA2 (HSPA2 Produkte)
- Hintergrund
-
HSPA2 (heat shock 70 kDa protein 2) is also known as HEAT-SHOCK PROTEIN, 70-KD, 2, HSP70-2, HEAT-SHOCK PROTEIN, 70-KD, 3 or HSP70-3. Analysis of the sequence indicated that HSPA2 is the human homolog of the murine Hsp70-2 gene, with 91.7 % identity in the nucleotide coding sequence and 98.2 % in the corresponding amino acid sequence. HSPA2 has less amino acid homology to the other members of the human HSP70 gene family. HSPA2 is constitutively expressed in most tissues, with very high levels in testis and skeletal muscle. The HSPA2 gene is located on chromosome 14q22-q24. Immunohistochemical analysis detected weak expression of HSPA2 in spermatocytes and stronger expression in spermatids and in the tail of mature sperm. HSPA2 may be critical to sperm maturation through its role as a protein chaperone.
Synonyms: 70 kDa antibody|DAQB 147D11.1 001 antibody|Hcp70.2 antibody|Heat shock 70 kDa protein 2 antibody|heat shock 70 kDa protein 1A antibody| Heat shock protein 2 antibody|heat shock protein 70 antibody|Heat shock protein 70.2 antibody|Heat shock related 70 kDa protein 2 antibody|Heat shock-related 70 kDa protein 2 antibody|Heat-shock protein, 70-KD, 2 antibody|Heat-shock protein, 70-KD, 3 antibody| HSP70 2 antibody|HSP70 3 antibody|Hsp70-2 antibody|HSP70-3 antibody|HSP70.2 antibody|HSP70A2 antibody|HSP72 antibody|HSP72_HUMAN antibody|HSPA2 antibody|Hspt70 antibody|Hst70 antibody|MGC58299 antibody|MGC7795 antibody|MGC93458 antibody|OTTHUMP00000180664 antibody|Testis-specific heat shock protein-related antibody|XXbac BCX40G17.3 001 antibody - Gen-ID
- 3306
- UniProt
- P54652
-