Monoamine Oxidase B Antikörper (C-Term)

Produktnummer ABIN3043873

Produktdetails anti-Monoamine Oxidase B Antikörper

Target: Monoamine Oxidase B (MAOB)

Bindungsspezifität: AA 448-484, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Monoamine Oxidase B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Amine oxidase [flavin-containing] B(MAOB) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: REILHAMGKI PEDEIWQSEP ESVDVPAQPI TTTFLER

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Amine oxidase [flavin-containing] B(MAOB) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: monoamine oxidase B
Protein Name: Amine oxidase [flavin-containing] B

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MAOB (448-484aa REILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLER), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu Monoamine Oxidase B

Target: Monoamine Oxidase B (MAOB)

Andere Bezeichnung: MAOB (MAOB Produkte)

Synonyme: MAOB antikoerper, Z-MAO antikoerper, maob antikoerper, moa antikoerper, wu:fb68b05 antikoerper, wu:fo76d11 antikoerper, wu:fq38g06 antikoerper, zgc:85761 antikoerper, MAOA antikoerper, 6330414K01Rik antikoerper, MAO-B antikoerper, monoamine oxidase B antikoerper, amine oxidase [flavin-containing] B antikoerper, monoamine oxidase antikoerper, monoamine oxidase B L homeolog antikoerper, MAOB antikoerper, Gbro_4276 antikoerper, LOC100223232 antikoerper, mao antikoerper, Maob antikoerper, maob.L antikoerper

Hintergrund: MAOB (MONOAMINE OXIDASE B), also called MAO, BRAIN, AMINE OXIDASE (FLAVIN-CONTAINING) B, is a protein that in humans is encoded by the MAOB gene. MAOB is a member of the flavin monoamine oxidase family. And it is mapped on Xp11.3. MAOB catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine. Like MAOA, it also degrades dopamine. MAO-B is involved in the breakdown of dopamine, a neurotransmitter implicated in reinforcing and motivating behaviors as well as movement. MAO-B inhibition is, therefore, associated with enhanced activity of dopamine, as well as with decreased production of hydrogen peroxide, a source of reactive oxygen species.

Synonyms: Adrenalin oxidase antibody|Amine oxidase (flavin containing) antibody|Amine oxidase [flavin-containing] B antibody|AOFB_HUMAN antibody|HGNC:6834 antibody|MAO, brain antibody| MAO, platelet antibody|MAO-B antibody|MAOB antibody|MGC26382 antibody|Monoamine oxidase B antibody|Monoamine oxidase type B antibody|OTTHUMP00000023166 antibody|RP1 201D17__B.1 antibody|Tyramine oxidase antibody

Gen-ID: 4129

UniProt: P27338