MMP8 Antikörper (N-Term)
-
- Target Alle MMP8 Antikörper anzeigen
- MMP8 (Matrix Metallopeptidase 8 (Neutrophil Collagenase) (MMP8))
-
Bindungsspezifität
- AA 119-153, N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MMP8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Neutrophil collagenase(MMP8) detection. Tested with WB, IHC-P, ELISA in Human.
- Sequenz
- NYTPQLSEAE VERAIKDAFE LWSVASPLIF TRISQ
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Neutrophil collagenase(MMP8) detection. Tested with WB, IHC-P, ELISA in Human.
Gene Name: matrix metallopeptidase 8 (neutrophil collagenase)
Protein Name: Neutrophil collagenase - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human MMP-8 (119-153aa NYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQ), different from the related mouse sequence by eleven amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product MMP8 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Hydrogen sulfide attenuates myocardial fibrosis in diabetic rats through the JAK/STAT signaling pathway." in: International journal of molecular medicine, Vol. 41, Issue 4, pp. 1867-1876, (2018) (PubMed).
: "H2S improves renal fibrosis in STZ-induced diabetic rats by ameliorating TGF-β1 expression." in: Renal failure, Vol. 39, Issue 1, pp. 265-272, (2017) (PubMed).
: "Glycyrrhizic acid alleviates bleomycin-induced pulmonary fibrosis in rats." in: Frontiers in pharmacology, Vol. 6, pp. 215, (2015) (PubMed).
: "Expression of matrix metalloproteinases-8 and -9 and their tissue inhibitor in the condyles of diabetic rats with mandibular advancement." in: Experimental and therapeutic medicine, Vol. 8, Issue 5, pp. 1357-1364, (2014) (PubMed).
: "
-
Hydrogen sulfide attenuates myocardial fibrosis in diabetic rats through the JAK/STAT signaling pathway." in: International journal of molecular medicine, Vol. 41, Issue 4, pp. 1867-1876, (2018) (PubMed).
-
- Target
- MMP8 (Matrix Metallopeptidase 8 (Neutrophil Collagenase) (MMP8))
- Andere Bezeichnung
- MMP8 (MMP8 Produkte)
- Synonyme
- MMP8 antikoerper, BB138268 antikoerper, CLG1 antikoerper, HNC antikoerper, MMP-8 antikoerper, PMNL-CL antikoerper, matrix metallopeptidase 8 antikoerper, neutrophil collagenase antikoerper, MMP8 antikoerper, Mmp8 antikoerper, LOC100339790 antikoerper
- Hintergrund
-
MMP8 (Matrix metalloproteinase 8) is a member of the family of matrix metalloproteinases. It is distinct from the collagenase of skin fibroblasts and synovial cells in substrate specificity and immunologic crossreactivity. MMP8 is mapped to 11q21-q22. MMP8 is an enzyme that degrades fibrillar collagens imparting strength to the fetal membranes, is expressed by leukocytes and chorionic cytotrophoblast cells. The enzyme exhibits 58 % homology to human fibroblast collagenase and has the same domain structure. It consists of a 20-residue signal peptide, and an 80-residue propeptide that is lost on autolytic activation by cleavage of an M-L bond. MMP8 was found to possess 57 % identity with the deduced protein sequence for fibroblast collagenase with 72 % chemical similarity. Matrix metalloproteinases (MMPs) have fundamental roles in tumor progression, but most clinical trials with MMP inhibitors have not shown improvements in individuals with cancer. MMP8 has a paradoxical protective role in cancer and provides a genetic model to evaluate the molecular basis of gender differences in cancer susceptibility.
Synonyms: CLG 1 antibody|CLG1 antibody|Collagenase 1 antibody|Collagenase 1 neutrophil antibody|HNC antibody|Matrix metallopeptidase 8 (neutrophil collagenase) antibody|Matrix metalloprotease 8 antibody|Matrix metalloproteinase-8 antibody|MMP 8 antibody|MMP-8 antibody| Mmp8 antibody| MMP8_HUMAN antibody|Neutrophil collagenase antibody|PMNL CL antibody|PMNL collagenase antibody|PMNL-CL antibody|PMNLCL antibody - Gen-ID
- 4317
- UniProt
- P22894
-