OGT Antikörper (C-Term)

Produktnummer ABIN3043893

Produktdetails anti-OGT Antikörper

Target: OGT (O-Linked N-Acetylglucosamine (GlcNAc) Transferase (UDP-N-Acetylglucosamine:polypeptide-N-Acetylglucosaminyl Transferase) (OGT))

Bindungsspezifität: AA 1008-1046, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OGT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit(OGT) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: NTKQYTMELE RLYLQMWEHY AAGNKPDHMI KPVEVTESA

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit(OGT) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: O-linked N-acetylglucosamine (GlcNAc) transferase
Protein Name: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human OGT (1008-1046aa NTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu OGT

Target: OGT (O-Linked N-Acetylglucosamine (GlcNAc) Transferase (UDP-N-Acetylglucosamine:polypeptide-N-Acetylglucosaminyl Transferase) (OGT))

Andere Bezeichnung: OGT (OGT Produkte)

Synonyme: BcDNA:GH04245 antikoerper, CG10392 antikoerper, Dmel\\CG10392 antikoerper, OGT antikoerper, Ogt antikoerper, P1201 antikoerper, SXC antikoerper, Sxc antikoerper, l(2)02637 antikoerper, l(2)NC130 antikoerper, sxc/Ogt antikoerper, fm81g08 antikoerper, ogt antikoerper, wu:fc12b01 antikoerper, wu:fm81g08 antikoerper, HRNT1 antikoerper, O-GLCNAC antikoerper, 1110038P24Rik antikoerper, 4831420N21Rik antikoerper, AI115525 antikoerper, Ogtl antikoerper, O-linked N-acetylglucosamine (GlcNAc) transferase L homeolog antikoerper, super sex combs antikoerper, O-linked N-acetylglucosamine (GlcNAc) transferase, tandem duplicate 1 antikoerper, O-linked N-acetylglucosamine (GlcNAc) transferase antikoerper, O-linked GlcNAc transferase antikoerper, o-linked GlcNAc transferase antikoerper, O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase) antikoerper, ogt.L antikoerper, sxc antikoerper, ogt.1 antikoerper, OGT antikoerper, ogt antikoerper, GL50803_12081 antikoerper, GL50803_41701 antikoerper, THAPSDRAFT_264441 antikoerper, spyA antikoerper, Ogt antikoerper

Hintergrund: O-linked N-acetylglucosamine (O-GlcNAc) transferase (OGT) is an enzyme that in humans is encoded by the OGT gene. This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains multiple tetratricopeptide repeats that are required for optimal recognition of substrates. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Synonyms: FLJ23071 antibody|GlcNAc transferase antibody|HRNT1 antibody|MGC22921 antibody|O GlcNAc antibody|O GlcNAc transferase p110 subunit antibody|O GlcNAc transferase subunit p110 antibody|O linked N acetylglucosamine (GlcNAc) transferase (UDP N acetylglucosamine: polypeptide N acetylglucosaminyl transferase) antibody|O linked N acetylglucosamine (GlcNAc) transferase antibody|O linked N acetylglucosamine transferase 110 kDa subunit antibody|O-GlcNAc transferase subunit p110 antibody|O-linked N-acetylglucosamine transferase 110 kDa subunit antibody|ogt antibody|OGT1_HUMAN antibody|UDP N acetylglucosamine peptide N acetylglucosaminyltransferase 110 kDa subunit antibody|UDP N acetylglucosamine peptide N acetylglucosaminyltransferase GlcNAc transferase antibody|UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit antibody|UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase antibody|Uridinediphospho N acetylglucosamine:polypeptide beta N acetylglucosaminyl transferase antibody

Gen-ID: 8473

UniProt: O15294

Pathways: Regulation of Carbohydrate Metabolic Process