PAK7 Antikörper (N-Term)

Produktnummer ABIN3043895

Produktdetails anti-PAK7 Antikörper

Target: PAK7 (P21 Protein (Cdc42/Rac)-Activated Kinase 7 (PAK7))

Bindungsspezifität: AA 26-55, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PAK7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase PAK 7(PAK7) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: DPQEQKFTGL PQQWHSLLAD TANRPKPMVD

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase PAK 7(PAK7) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: p21 protein (Cdc42/Rac)-activated kinase 7
Protein Name: Serine/threonine-protein kinase PAK 7

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PAK5 (26-55aa DPQEQKFTGLPQQWHSLLADTANRPKPMVD), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu PAK7

Target: PAK7 (P21 Protein (Cdc42/Rac)-Activated Kinase 7 (PAK7))

Andere Bezeichnung: PAK7 (PAK7 Produkte)

Synonyme: PAK5 antikoerper, pak5 antikoerper, 2900083L08Rik antikoerper, 6430627N20 antikoerper, Pak5 antikoerper, PAK-5 antikoerper, PAK-7 antikoerper, p21 (RAC1) activated kinase 5 antikoerper, p21 (RAC1) activated kinase 5 L homeolog antikoerper, p21 protein (Cdc42/Rac)-activated kinase 7 antikoerper, p21 (RAC1) activated kinase 7 antikoerper, PAK5 antikoerper, pak5.L antikoerper, Pak7 antikoerper

Hintergrund: Serine/threonine-protein kinase PAK 7, also known as PAK5, is an enzyme that in humans is encoded by the PAK7 gene. The protein encoded by this gene is a member of the PAK family of Ser/Thr protein kinases. PAK family members are known to be effectors of Rac/Cdc42 GTPases, which have been implicated in the regulation of cytoskeletal dynamics, proliferation, and cell survival signaling. This kinase contains a CDC42/Rac1 interactive binding (CRIB) motif, and has been shown to bind CDC42 in the presence of GTP. And this kinase is predominantly expressed in brain. It is capable of promoting neurite outgrowth, and thus may play a role in neurite development. In addition, this kinase is associated with microtubule networks and induces microtubule stabilization. The subcellular localization of this kinase is tightly regulated during cell cycle progression. Alternatively spliced transcript variants encoding the same protein have been described.

Synonyms: EC 2.7.11.1 antibody|KIAA1264 antibody|MGC26232 antibody|p21 activated kinase 7 antibody|p21 protein (Cdc42/Rac)-activated kinase 7 antibody|p21(CDKN1A) activated kinase 7 antibody|p21-activated kinase 5 antibody|p21-activated kinase 7 antibody|PAK 5 antibody|PAK 7 antibody|PAK-5 antibody|PAK-7 antibody|PAK5 antibody|PAK7 antibody|PAK7_HUMAN antibody|Protein kinase PAK5 antibody|Serine/threonine protein kinase PAK 7 antibody|Serine/threonine-protein kinase PAK 7 antibody

Gen-ID: 57144

UniProt: Q9P286