POMC Antikörper (Middle Region)

Produktnummer ABIN3043901

Produktdetails anti-POMC Antikörper

Target: POMC (Proopiomelanocortin (POMC))

Bindungsspezifität: AA 138-176, Middle Region

Reaktivität: Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser POMC Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Pro-opiomelanocortin(POMC) detection. Tested with IHC-P in Human,Mouse,Rat.

Sequenz: SYSMEHFRWG KPVGKKRRPV KVYPNGAEDE SAEAFPLEF

Kreuzreaktivität (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Produktmerkmale: Rabbit IgG polyclonal antibody for Pro-opiomelanocortin(POMC) detection. Tested with IHC-P in Human,Mouse,Rat.
Gene Name: proopiomelanocortin
Protein Name: Pro-opiomelanocortin

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ACTH(138-176aa SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF), different from the related mouse and rat sequences by two amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-POMC Antikörper (ABIN3043901)

Huo, Liu, Wang, Zhang, Wang, Yang, Sun, Xu: "Early hyperbaric oxygen therapy inhibits aquaporin 4 and adrenocorticotropic hormone expression in the pituitary gland of rabbits with blast-induced craniocerebral injury." in: Neural regeneration research, Vol. 7, Issue 22, pp. 1729-35, (2015) (PubMed).

Chen, Wang, Zhao, Zhang, Huang: "Effects of the extract of a Chinese herb Tripterygium wilfordii hook f on rat pituitary gland." in: The American journal of Chinese medicine, Vol. 33, Issue 6, pp. 945-55, (2006) (PubMed).

Details zu POMC

Target: POMC (Proopiomelanocortin (POMC))

Andere Bezeichnung: POMC (POMC Produkte)

Synonyme: MSH antikoerper, ACTH antikoerper, pomc antikoerper, SI:bZ36D5.1 antikoerper, SI:bZ36D5.4 antikoerper, si:bz36d5.2 antikoerper, BE antikoerper, Beta-LPH antikoerper, Clip antikoerper, Gamma-LPH antikoerper, Npp antikoerper, Pomc-1 antikoerper, Pomc1 antikoerper, alpha-MSH antikoerper, alphaMSH antikoerper, beta-MSH antikoerper, gamma-MSH antikoerper, CLIP antikoerper, LPH antikoerper, NPP antikoerper, POC antikoerper, Pomc2 antikoerper, proopiomelanocortin a antikoerper, pro-opiomelanocortin-alpha antikoerper, proopiomelanocortin antikoerper, pomca antikoerper, Pomc antikoerper, POMC antikoerper

Hintergrund: Adrenocorticotropic hormone (ACTH), also known as corticotropin, is a polypeptide tropic hormone produced and secreted by the anterior pituitary gland. It is an important component of the hypothalamic-pituitary-adrenal axis and is often produced in response to biological stress (along with its precursor corticotropin-releasing hormone from the hypothalamus). Its principal effects are increased production and release of corticosteroids. ACTH stimulates secretion of glucocorticoid steroid hormones from adrenal cortex cells, especially in the zona fasciculata of the adrenal glands. This gene can influence steroid hormone secretion by both rapid short-term mechanisms that take place within minutes and slower long-term actions. Besides, ACTH also enhances transcription of mitochondrial genes that encode for subunits of mitochondrial oxidative phosphorylation systems.

Synonyms: ACTH antibody|Adrenocorticotropic hormone antibody|Adrenocorticotropin antibody|Adrenocorticotropin Hormone antibody|Alpha Melanocyte Stimulating Hormone antibody|alpha-MSH antibody|alphaMSH antibody|Beta Endorphin antibody|Beta Lipotropin antibody|Beta LPH antibody|Beta Melanocyte Stimulating Hormone antibody|Beta-endorphin antibody|beta-MSH antibody|CLIP antibody|Corticotropin antibody|Corticotropin Like Intermediary Peptide antibody|Corticotropin lipotropin antibody|Corticotropin lipotropin precursor antibody|Corticotropin-like intermediary peptide antibody|Gamma LPH antibody|gamma-MSH antibody|Lipotropin Beta antibody|Lipotropin Gamma antibody|Lipotropin, included antibody|LPH antibody|Melanocyte-stimulating hormone, included antibody|Melanotropin Alpha antibody|Melanotropin beta antibody|Melanotropin gamma antibody|Melanotropin, included antibody|Met Enkephalin antibody|Met-enkephalin antibody|MSH antibody|NPP antibody|Opiomelanocortin prepropeptide antibody|POC antibody|POMC antibody|Pomc-1 antibody|Pomc1 antibody|Pomc2 antibody|Pro ACTH endorphin antibody|Pro opiomelanocortin antibody|Pro-opiomelanocortin-alpha antibody|Proopiomelanocortin antibody|Proopiomelanocortin preproprotein antibody|Tetracosactide antibody

Gen-ID: 5443

UniProt: P01189

Pathways: Metabolism of Steroid Hormones and Vitamin D, Peptide Hormone Metabolism, Hormone Activity, Feeding Behaviour