PPP1R12A Antikörper (N-Term)
-
- Target Alle PPP1R12A Antikörper anzeigen
- PPP1R12A (Myosin Phosphatase, Target Subunit 1 (PPP1R12A))
-
Bindungsspezifität
- AA 1-40, N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PPP1R12A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Protein phosphatase 1 regulatory subunit 12A(PPP1R12A) detection. Tested with WB, IHC-P in Human,Mouse.
- Sequenz
- MKMADAKQKR NEQLKRWIGS ETDLEPPVVK RQKTKVKFDD
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Protein phosphatase 1 regulatory subunit 12A(PPP1R12A) detection. Tested with WB, IHC-P in Human,Mouse.
Gene Name: protein phosphatase 1, regulatory subunit 12A
Protein Name: Protein phosphatase 1 regulatory subunit 12A - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human PPP1R12A (1-40aa MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDD), identical to the related mouse and rat sequences.
- Isotyp
- IgG
- Top Product
- Discover our top product PPP1R12A Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
The role of Rho/Rho-kinase pathway and the neuroprotective effects of fasudil in chronic cerebral ischemia." in: Neural regeneration research, Vol. 10, Issue 9, pp. 1441-9, (2015) (PubMed).
: "
-
The role of Rho/Rho-kinase pathway and the neuroprotective effects of fasudil in chronic cerebral ischemia." in: Neural regeneration research, Vol. 10, Issue 9, pp. 1441-9, (2015) (PubMed).
-
- Target
- PPP1R12A (Myosin Phosphatase, Target Subunit 1 (PPP1R12A))
- Andere Bezeichnung
- PPP1R12A (PPP1R12A Produkte)
- Hintergrund
-
PPP1R12A (Protein phosphatase 1 regulatory subunit 12A), also called MYPT1 (Myosin phosphatase target subunit 1), is an enzyme that in humans is encoded by the PPP1R12A gene. PPP1R12A is one of the subunits of myosin phosphatase. Sequencing analysis showed that human PPP1R12A contains 1,030 amino acids with a calculated molecular mass of approximately 115 kD. The PPP1R12A gene is mapped on 12q21.2-q21.3. PPP1R12A is the protein that regulates PP1 function in smooth muscle relaxation. The cellular MYPT1-PP1-delta -specific inhibitor CPI17 caused a loss of merlin function characterized by merlin phosphorylation, Ras activation, and transformation. Jin et al. concluded that PPP1R12A and its substrate merlin are part of a previously undescribed tumor suppressor cascade that can be hindered in two ways, by mutation of the NF2 gene and by upregulation of the oncoprotein CPI17.
Synonyms: M130 antibody|MBS antibody|MGC133042 antibody|Myosin binding subunit antibody|Myosin phosphatase target subunit 1 antibody|Myosin phosphatase targeting subunit 1 antibody| Myosin phosphatase-targeting subunit 1 antibody|MYPT 1 antibody|MYPT1 antibody|MYPT1_HUMAN antibody|PPP1R12A antibody|Protein phosphatase 1 regulatory inhibitor subunit 12A antibody| Protein phosphatase 1 regulatory subunit 12A antibody|Protein phosphatase 1, regulatory (inhibitor) subunit 12A antibody|Protein phosphatase myosin binding subunit antibody| Protein phosphatase myosin-binding subunit antibody - Gen-ID
- 4659
- UniProt
- O14974
- Pathways
- M Phase
-