PTP4A2 Antikörper (N-Term)
-
- Target Alle PTP4A2 Antikörper anzeigen
- PTP4A2 (Protein tyrosine Phosphatase Type IVA, Member 2 (PTP4A2))
-
Bindungsspezifität
- AA 40-69, N-Term
- Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PTP4A2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Protein tyrosine phosphatase type IVA 2(PTP4A2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- TTLVRVCDAT YDKAPVEKEG IHVLDWPFDD
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Protein tyrosine phosphatase type IVA 2(PTP4A2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: protein tyrosine phosphatase type IVA, member 2
Protein Name: Protein tyrosine phosphatase type IVA 2 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human PTP4A2 (40-69aa TTLVRVCDATYDKAPVEKEGIHVLDWPFDD), identical to the related mouse and rat sequences.
- Isotyp
- IgG
- Top Product
- Discover our top product PTP4A2 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- PTP4A2 (Protein tyrosine Phosphatase Type IVA, Member 2 (PTP4A2))
- Andere Bezeichnung
- PTP4A2 (PTP4A2 Produkte)
- Synonyme
- wu:fc05f09 antikoerper, wu:fi84b06 antikoerper, zgc:101724 antikoerper, MGC53390 antikoerper, MGC80084 antikoerper, MGC132077 antikoerper, PTP4A2 antikoerper, ptp4a2 antikoerper, Prl-2 antikoerper, HH13 antikoerper, HH7-2 antikoerper, HU-PP-1 antikoerper, OV-1 antikoerper, PRL-2 antikoerper, PRL2 antikoerper, PTP4A antikoerper, PTPCAAX2 antikoerper, ptp-IV1a antikoerper, ptp-IV1b antikoerper, protein tyrosine phosphatase type IVA, member 2b antikoerper, protein tyrosine phosphatase 4a2 antikoerper, protein tyrosine phosphatase type IVA, member 2 antikoerper, protein tyrosine phosphatase type IVA, member 2 L homeolog antikoerper, ptp4a2b antikoerper, ptp4a2 antikoerper, PTP4A2 antikoerper, ptp4a2.L antikoerper, Ptp4a2 antikoerper
- Hintergrund
-
Protein tyrosine phosphatase type IVA 2 is an enzyme that in humans is encoded by the PTP4A2 gene. The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 11, 12 and 17.
Synonyms: BM 008 antibody|EC 3.1.3.48 antibody|HH 13 antibody|HH13 antibody|HH7 2 antibody|HU PP 1 antibody|HUPP 1 antibody|HUPP1 antibody|OV 1 antibody|OV1 antibody|phosphatase of regenerating liver 2 antibody|PRL 2 antibody|PRL2 antibody|Protein tyrosine phosphatase 4a2 antibody|protein tyrosine phosphatase IVA antibody|protein tyrosine phosphatase IVA2 antibody|Protein tyrosine phosphatase of regenerating liver 2 antibody|protein tyrosine phosphatase type IVA 2 antibody|Protein tyrosine phosphatase type IVA member 2 isoform 1 antibody|protein tyrosine phosphatase type IVA, member 2 antibody|PTP (CAAXII) antibody|ptp IV1a antibody|ptp IV1b antibody|PTP4A antibody|PTPCAAX2 antibody|TP4A2_HUMAN antibody - Gen-ID
- 8073
- UniProt
- Q12974
-