SLC22A2 Antikörper (Middle Region)
-
- Target Alle SLC22A2 Antikörper anzeigen
- SLC22A2 (Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2))
-
Bindungsspezifität
- AA 524-555, Middle Region
-
Reaktivität
- Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC22A2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Solute carrier family 22 member 2(SLC22A2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- ETIEEAENMQ RPRKNKEKMI YLQVQKLDIP LN
- Kreuzreaktivität (Details)
-
Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities. - Produktmerkmale
-
Rabbit IgG polyclonal antibody for Solute carrier family 22 member 2(SLC22A2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: solute carrier family 22 (organic cation transporter), member 2
Protein Name: Solute carrier family 22 member 2 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human SLC22A2 (524-555aa ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product SLC22A2 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human , The detection limit for SLC22A2 is approximately 0.1 ng/lane under reducing conditions.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- SLC22A2 (Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2))
- Andere Bezeichnung
- SLC22A2 (SLC22A2 Produkte)
- Synonyme
- OCT2 antikoerper, Oct2 antikoerper, Orct2 antikoerper, OCT2r antikoerper, rOCT2 antikoerper, Pou2f2 antikoerper, OCT2P antikoerper, oct1 antikoerper, wu:fc01b11 antikoerper, zgc:64076 antikoerper, slc22a2 antikoerper, solute carrier family 22 member 2 antikoerper, solute carrier family 22 (organic cation transporter), member 2 antikoerper, POU class 2 homeobox 2 antikoerper, solute carrier family 22 (organic cation transporter), member 2 L homeolog antikoerper, SLC22A2 antikoerper, Slc22a2 antikoerper, POU2F2 antikoerper, LOC521027 antikoerper, slc22a2 antikoerper, slc22a2.L antikoerper
- Hintergrund
-
SLC22A2 is also known as OCT2. It is mapped to 6q25.3. Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. It is found primarily in the kidney, where it may mediate the first step in cation reabsorption.
Synonyms: MGC32628 antibody|OCT 2 antibody|OCT2 antibody|Organic cation transporter 2 antibody|Organic cation transporter antibody|RP11-317M22.2 antibody|Solute carrier family 22 (organic cation transporter) member 2 antibody|Solute carrier family 22 member 2 antibody - Gen-ID
- 6582
- UniProt
- O15244
-