UBA3 Antikörper (C-Term)

Produktnummer ABIN3043952

Produktdetails anti-UBA3 Antikörper

Target: UBA3 (Ubiquitin-Like Modifier Activating Enzyme 3 (UBA3))

Bindungsspezifität: AA 409-448, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for NEDD8-activating enzyme E1 catalytic subunit(UBA3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: KNRTLYLQSV TSIEERTRPN LSKTLKELGL VDGQELAVAD

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for NEDD8-activating enzyme E1 catalytic subunit(UBA3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: ubiquitin-like modifier activating enzyme 3
Protein Name: NEDD8-activating enzyme E1 catalytic subunit

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human UBE1C (409-448aa KNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVAD), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu UBA3

Target: UBA3 (Ubiquitin-Like Modifier Activating Enzyme 3 (UBA3))

Andere Bezeichnung: UBA3 (UBA3 Produkte)

Synonyme: UBE1C antikoerper, hUBA3 antikoerper, Ube1c antikoerper, ube1c antikoerper, wu:fb75e04 antikoerper, wu:fc37b11 antikoerper, zgc:55528 antikoerper, A830034N06Rik antikoerper, AI256736 antikoerper, AI848246 antikoerper, AW546539 antikoerper, ubiquitin like modifier activating enzyme 3 antikoerper, ubiquitin-like modifier activating enzyme 3 antikoerper, ubiquitin like modifier activating enzyme 3 S homeolog antikoerper, UBA3 antikoerper, Uba3 antikoerper, uba3 antikoerper, uba3.S antikoerper

Hintergrund: NEDD8-activating enzyme E1 catalytic subunit is a protein that in humans is encoded by the UBA3 gene. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and then the enzyme complex activates NEDD8, an ubiquitin-like protein, which regulates cell division, signaling and embryogenesis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Synonyms: DKFZp566J164 antibody|EC 6.3.2. antibody|hUba3 antibody|MGC22384 antibody|NEDD8 activating enzyme E1 catalytic subunit antibody|NEDD8 activating enzyme E1C antibody|Nedd8 activating enzyme hUba3 antibody|NEDD8-activating enzyme E1 catalytic subunit antibody|NEDD8-activating enzyme E1C antibody|uba3 antibody|UBA3 ubiquitin activating enzyme E1 homolog antibody|UBA3_HUMAN antibody|UBE1C antibody| Ubiquitin activating enzyme 3 antibody|Ubiquitin activating enzyme E1C antibody|Ubiquitin-activating enzyme 3 antibody|Ubiquitin-activating enzyme E1C antibody|Ubiquitin-like modifier-activating enzyme 3 antibody

Gen-ID: 9039