MDM4-binding Protein Antikörper (N-Term)

Produktnummer ABIN3044527

Produktdetails anti-MDM4-binding Protein Antikörper

Target: MDM4-binding Protein (MDM4) (Mdm4-binding Protein (MDM4))

Bindungsspezifität: AA 35-72, N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MDM4-binding Protein Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Protein Mdm4(MDM4) detection. Tested with WB, IHC-P in Human,Mouse.

Sequenz: KILHAAGAQG EMFTVKEVMH YLGQYIMVKQ LYDQQEQH

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Protein Mdm4(MDM4) detection. Tested with WB, IHC-P in Human,Mouse.
Gene Name: MDM4, p53 regulator
Protein Name: Protein Mdm4

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MDMX (35-72aa KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu MDM4-binding Protein

Target: MDM4-binding Protein (MDM4) (Mdm4-binding Protein (MDM4))

Andere Bezeichnung: MDM4 (MDM4 Produkte)

Synonyme: mdmx antikoerper, HDMX antikoerper, MDMX antikoerper, MRP1 antikoerper, wu:fa09h09 antikoerper, wu:fi33d10 antikoerper, 4933417N07Rik antikoerper, AA414968 antikoerper, AL023055 antikoerper, AU018793 antikoerper, AU021806 antikoerper, C85810 antikoerper, Mdmx antikoerper, MDM4, p53 regulator S homeolog antikoerper, MDM4, p53 regulator antikoerper, transformed mouse 3T3 cell double minute 4 antikoerper, mdm4.S antikoerper, MDM4 antikoerper, Mdm4 antikoerper, mdm4 antikoerper

Hintergrund: Protein Mdm4 is a protein that in humans is encoded by the MDM4 gene. This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, and shows structural similarity to p53-binding protein MDM2. Both proteins bind the p53 tumor suppressor protein and inhibit its activity, and have been shown to be overexpressed in a variety of human cancers. However, unlike MDM2 which degrades p53, this protein inhibits p53 by binding its transcriptional activation domain. This protein also interacts with MDM2 protein via the RING finger domain, and inhibits the latter's degradation. So this protein can reverse MDM2-targeted degradation of p53, while maintaining suppression of p53 transactivation and apoptotic functions. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Synonyms: DKFZp781B1423 antibody|Double minute 4 antibody|Double minute 4 human homolog of p53 binding protein antibody|Double minute 4 protein antibody|HDMX antibody|MDM 4 antibody|Mdm2 like p53 binding protein antibody|Mdm2-like p53-binding protein antibody|MDM4 antibody|Mdm4 p53 binding protein homolog mouse antibody|Mdm4 protein antibody|MDM4 related protein 1 antibody|Mdm4 transformed 3T3 cell double minute 4 antibody|Mdm4 transformed 3T3 cell double minute 4 p53 binding protein antibody|Mdm4 transformed 3T3 cell double minute 4 p53 binding protein mouse antibody|MDM4_HUMAN antibody|Mdmx protein antibody|MGC132766 antibody|Mouse double minute 4 homolog antibody| Mouse double minute 4 human homolog of p53 binding protein antibody|MRP 1 antibody|MRP1 antibody|p53 binding protein antibody|p53 BINDING PROTEIN MDM4 antibody|p53-binding protein Mdm4 antibody|Protein Mdm4 antibody|Protein Mdmx antibody

Gen-ID: 4194

UniProt: O15151

Pathways: Zellzyklus