TPP1 Antikörper (Middle Region)

Produktnummer ABIN3044554

Produktdetails anti-TPP1 Antikörper

Target: TPP1 (Tripeptidyl Peptidase I (TPP1))

Bindungsspezifität: AA 227-261, Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TPP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Tripeptidyl-peptidase 1(TPP1) detection. Tested with WB, IHC-P in Human.

Sequenz: CAQFLEQYFH DSDLAQFMRL FGGNFAHQAS VARVV

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Tripeptidyl-peptidase 1(TPP1) detection. Tested with WB, IHC-P in Human.
Gene Name: tripeptidyl peptidase I
Protein Name: Tripeptidyl-peptidase 1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human TPP1 (227-261aa CAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVV), different from the related mouse sequence by six amino acids, and from the related rat sequence by five amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu TPP1

Target: TPP1 (Tripeptidyl Peptidase I (TPP1))

Andere Bezeichnung: TPP1 (TPP1 Produkte)

Synonyme: cln2 antikoerper, fa01b09 antikoerper, im:7149243 antikoerper, wu:fa01b09 antikoerper, CLN2 antikoerper, LPIC antikoerper, TPP-1 antikoerper, TPP-I antikoerper, Cln2 antikoerper, tripeptidyl peptidase I antikoerper, tripeptidyl-peptidase 1 antikoerper, tripeptidyl peptidase 1 antikoerper, tpp1 antikoerper, NAEGRDRAFT_78259 antikoerper, MCYG_00184 antikoerper, MGYG_05881 antikoerper, MGYG_00757 antikoerper, TPP1 antikoerper, Tpp1 antikoerper

Hintergrund: Tripeptidyl-peptidase 1, also known as Lysosomal pepstatin-insensitive protease, is an enzyme that in humans is encoded by the TPP1 gene. This gene encodes a member of the sedolisin family of serine proteases. The protease functions in the lysosome to cleave N-terminal tripeptides from substrates, and has weaker endopeptidase activity. It is synthesized as a catalytically-inactive enzyme which is activated and auto-proteolyzed upon acidification. Mutations in this gene result in late-infantile neuronal ceroid lipofuscinosis, which is associated with the failure to degrade specific neuropeptides and a subunit of ATP synthase in the lysosome.

Synonyms: Cell growth inhibiting gene 1 protein antibody|Cell growth-inhibiting gene 1 protein antibody|Ceroid lipofuscinosis neuronal 2 antibody|Ceroid lipofuscinosis neuronal 2 late infantile (Jansky Bielschowsky disease) antibody|Ceroid lipofuscinosis neuronal 2 late infantile antibody|CLN 2 antibody|CLN2 antibody|GIG 1 antibody|GIG1 antibody|Growth inhibiting protein 1 antibody|LPIC antibody| Lysosomal pepstatin insensitive protease antibody|Lysosomal pepstatin-insensitive protease antibody|MGC21297 antibody|TPP 1 antibody| TPP I antibody|TPP-1 antibody|TPP-I antibody|Tpp1 antibody|TPP1_HUMAN antibody|TPPI antibody|Tripeptidyl aminopeptidase antibody| Tripeptidyl peptidase I antibody|Tripeptidyl-peptidase 1 antibody|Tripeptidyl-peptidase I antibody

Gen-ID: 1200

UniProt: O14773

Pathways: Zellzyklus, ER-Nucleus Signaling